PRPS2 (NM_001039091) Human Mass Spec Standard
CAT#: PH319227
PRPS2 MS Standard C13 and N15-labeled recombinant protein (NP_001034180)
View other "PRPS2" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | PRPS2 MS Standard C13 and N15-labeled recombinant protein (NP_001034180) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219227 |
Predicted MW | 34.9 kDa |
Protein Sequence |
>RC219227 representing NM_001039091
Red=Cloning site Green=Tags(s) MPNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRGEDVYIIQSGCGEINDNLMEL LIMINACKIASSSRVTAVIPCFPYARQDKKDKVGESRAPISAKLVANMLSVAGADHIITMDLHASQIQGF FDIPVDNLYAEPAVLQWIRENIAEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVL VGDVKDRVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISRINNAAFEAVVVTNTIPQ EDKMKHCTKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001034180 |
RefSeq Size | 2518 |
RefSeq ORF | 963 |
Synonyms | PRSII |
Locus ID | 5634 |
Cytogenetics | Xp22.2 |
Summary | This gene encodes a phosphoribosyl pyrophosphate synthetase that plays a central role in the synthesis of purines and pyrimidines. The encoded protein catalyzes the synthesis of 5-phosphoribosyl 1-pyrophosphate from ATP and D-ribose 5-phosphate. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010] |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Pentose phosphate pathway, Purine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419123 | PRPS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422014 | PRPS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419123 | Transient overexpression lysate of phosphoribosyl pyrophosphate synthetase 2 (PRPS2), transcript variant 2 |
CNY 3,080.00 |
|
LY422014 | Transient overexpression lysate of phosphoribosyl pyrophosphate synthetase 2 (PRPS2), transcript variant 1 |
CNY 3,080.00 |
|
TP319227 | Recombinant protein of human phosphoribosyl pyrophosphate synthetase 2 (PRPS2), transcript variant 1, 20 µg |
CNY 2,900.00 |