PRPS2 (NM_001039091) Human Recombinant Protein
CAT#: TP319227
Recombinant protein of human phosphoribosyl pyrophosphate synthetase 2 (PRPS2), transcript variant 1, 20 µg
View other "PRPS2" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 6,281.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219227 representing NM_001039091
Red=Cloning site Green=Tags(s) MPNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRGEDVYIIQSGCGEINDNLMEL LIMINACKIASSSRVTAVIPCFPYARQDKKDKVGESRAPISAKLVANMLSVAGADHIITMDLHASQIQGF FDIPVDNLYAEPAVLQWIRENIAEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVL VGDVKDRVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISRINNAAFEAVVVTNTIPQ EDKMKHCTKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 34.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001034180 |
Locus ID | 5634 |
UniProt ID | P11908, A0A140VK41 |
Refseq Size | 2518 |
Cytogenetics | Xp22.2 |
Refseq ORF | 963 |
Synonyms | PRSII |
Summary | This gene encodes a phosphoribosyl pyrophosphate synthetase that plays a central role in the synthesis of purines and pyrimidines. The encoded protein catalyzes the synthesis of 5-phosphoribosyl 1-pyrophosphate from ATP and D-ribose 5-phosphate. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010] |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Pentose phosphate pathway, Purine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419123 | PRPS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422014 | PRPS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419123 | Transient overexpression lysate of phosphoribosyl pyrophosphate synthetase 2 (PRPS2), transcript variant 2 |
CNY 3,080.00 |
|
LY422014 | Transient overexpression lysate of phosphoribosyl pyrophosphate synthetase 2 (PRPS2), transcript variant 1 |
CNY 3,080.00 |
|
PH319227 | PRPS2 MS Standard C13 and N15-labeled recombinant protein (NP_001034180) |
CNY 19,520.00 |