SETD7 (NM_030648) Human Mass Spec Standard
CAT#: PH319244
SETD7 MS Standard C13 and N15-labeled recombinant protein (NP_085151)
View other "SETD7" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | SETD7 MS Standard C13 and N15-labeled recombinant protein (NP_085151) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219244 |
Predicted MW | 40.5 kDa |
Protein Sequence |
>RC219244 representing NM_030648
Red=Cloning site Green=Tags(s) MDSDDEMVEEAVEGHLDDDGLPHGFCTVTYSSTDRFEGNFVHGEKNGRGKFFFFDGSTLEGYYVDDALQG QGVYTYEDGGVLQGTYVDGELNGPAQEYDTDGRLIFKGQYKDNIRHGVCWIYYPDGGSLVGEVNEDGEMT GEKIAYVYPDERTALYGKFIDGEMIEGKLATLMSTEEGRPHFELMPGNSVYHFDKSTSSCISTNALLPDP YESERVYVAESLISSAGEGLFSKVAVGPNTVMSFYNGVRITHQEVDSRDWALNGNTLSLDEETVIDVPEP YNHVSKYCASLGHKANHSFTPNCIYDMFVHPRFGPIKCIRTLRAVEADEELTVAYGYDHSPPGKSGPEAP EWYQVELKAFQATQQK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_085151 |
RefSeq Size | 7012 |
RefSeq ORF | 1098 |
Synonyms | KMT7; SET7; SET7/9; SET9 |
Locus ID | 80854 |
Cytogenetics | 4q31.1 |
Summary | Histone methyltransferase that specifically monomethylates 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. Plays a central role in the transcriptional activation of genes such as collagenase or insulin. Recruited by IPF1/PDX-1 to the insulin promoter, leading to activate transcription. Has also methyltransferase activity toward non-histone proteins such as p53/TP53, TAF10, and possibly TAF7 by recognizing and binding the [KR]-[STA]-K in substrate proteins. Monomethylates 'Lys-189' of TAF10, leading to increase the affinity of TAF10 for RNA polymerase II. Monomethylates 'Lys-372' of p53/TP53, stabilizing p53/TP53 and increasing p53/TP53-mediated transcriptional activation.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Protein Pathways | Lysine degradation |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403067 | SETD7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403067 | Transient overexpression lysate of SET domain containing (lysine methyltransferase) 7 (SETD7) |
CNY 3,080.00 |
|
TP319244 | Recombinant protein of human SET domain containing (lysine methyltransferase) 7 (SETD7), 20 µg |
CNY 2,900.00 |