United States
Germany
Japan
United Kingdom
China
EED (NM_003797) Human Mass Spec Standard
CAT＃: PH319261
EED MS Standard C13 and N15-labeled recombinant protein (NP_003788)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | EED MS Standard C13 and N15-labeled recombinant protein (NP_003788) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC219261 |
| Predicted MW | 50 kDa |
| Protein Sequence |
>RC219261 representing NM_003797
Red=Cloning site Green=Tags(s) MSEREVSTAPAGTDMPAAKKQKLSSDENSNPDLSGDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGK GKWKSKKCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSYVD ADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVS KDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDY NPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNV TILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSR DSSILIAVCDDASIWRWDRLR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003788 |
| RefSeq Size | 2006 |
| RefSeq ORF | 1323 |
| Synonyms | COGIS; HEED; WAIT1 |
| Locus ID | 8726 |
| Cytogenetics | 11q14.2 |
| Summary | This gene encodes a member of the Polycomb-group (PcG) family. PcG family members form multimeric protein complexes, which are involved in maintaining the transcriptional repressive state of genes over successive cell generations. This protein interacts with enhancer of zeste 2, the cytoplasmic tail of integrin beta7, immunodeficiency virus type 1 (HIV-1) MA protein, and histone deacetylase proteins. This protein mediates repression of gene activity through histone deacetylation, and may act as a specific regulator of integrin function. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401248 | EED HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC407233 | EED HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401248 | Transient overexpression lysate of embryonic ectoderm development (EED), transcript variant 1 |
CNY 4,840.00 |
|
| LY407233 | Transient overexpression lysate of embryonic ectoderm development (EED), transcript variant 2 |
CNY 3,080.00 |
|
| PH324366 | EED MS Standard C13 and N15-labeled recombinant protein (NP_694536) |
CNY 19,520.00 |
|
| TP319261 | Recombinant protein of human embryonic ectoderm development (EED), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP324366 | Recombinant protein of human embryonic ectoderm development (EED), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP760652 | Purified recombinant protein of Human embryonic ectoderm development (EED), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |
|
| TP761504 | Purified recombinant protein of Human embryonic ectoderm development (EED), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
