EED (NM_152991) Human Recombinant Protein
CAT#: TP324366
Recombinant protein of human embryonic ectoderm development (EED), transcript variant 2, 20 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC224366 representing NM_152991
Red=Cloning site Green=Tags(s) MSEREVSTAPAGTDMPAAKKQKLSSDENSNPDLSGDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGK GKWKSKKCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSYVD ADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVS KDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDY NPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNV TILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 45.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_694536 |
Locus ID | 8726 |
UniProt ID | O75530 |
Refseq Size | 2413 |
Cytogenetics | 11q14.2 |
Refseq ORF | 1200 |
Synonyms | COGIS; HEED; WAIT1 |
Summary | This gene encodes a member of the Polycomb-group (PcG) family. PcG family members form multimeric protein complexes, which are involved in maintaining the transcriptional repressive state of genes over successive cell generations. This protein interacts with enhancer of zeste 2, the cytoplasmic tail of integrin beta7, immunodeficiency virus type 1 (HIV-1) MA protein, and histone deacetylase proteins. This protein mediates repression of gene activity through histone deacetylation, and may act as a specific regulator of integrin function. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401248 | EED HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC407233 | EED HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401248 | Transient overexpression lysate of embryonic ectoderm development (EED), transcript variant 1 |
CNY 4,840.00 |
|
LY407233 | Transient overexpression lysate of embryonic ectoderm development (EED), transcript variant 2 |
CNY 3,080.00 |
|
PH319261 | EED MS Standard C13 and N15-labeled recombinant protein (NP_003788) |
CNY 19,520.00 |
|
PH324366 | EED MS Standard C13 and N15-labeled recombinant protein (NP_694536) |
CNY 19,520.00 |
|
TP319261 | Recombinant protein of human embryonic ectoderm development (EED), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP760652 | Purified recombinant protein of Human embryonic ectoderm development (EED), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |
|
TP761504 | Purified recombinant protein of Human embryonic ectoderm development (EED), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |