TREML1 (NM_178174) Human Mass Spec Standard
CAT#: PH319476
TREML1 MS Standard C13 and N15-labeled recombinant protein (NP_835468)
View other "TREML1" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | TREML1 MS Standard C13 and N15-labeled recombinant protein (NP_835468) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219476 |
Predicted MW | 32.5 kDa |
Protein Sequence |
>RC219476 representing NM_178174
Red=Cloning site Green=Tags(s) MGLTLLLLLLLGLEGQGIVGSLPEVLQAPVGSSILVQCHYRLQDVKAQKVWCRFLPEGCQPLVSSAVDRR APAGRRTFLTDLGGGLLQVEMVTLQEEDAGEYGCMVDGARGPQILHRVSLNILPPEEEEETHKIGSLAEN AFSDPAGSANPLEPSQDEKSIPLIWGAVLLVGLLVAAVVLFAVMAKRKQGNRLGVCGRFLSSRVSGMNPS SVVHHVSDSGPAAELPLDVPHIRLDSPPSFDNTTYTSLPLDSPSGKPSLPAPSSLPPLPPKVLVCSKPVT YATVIFPGGNKGGGTSCGPAQNPPNNQTPSS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_835468 |
RefSeq Size | 980 |
RefSeq ORF | 933 |
Synonyms | dJ238O23.3; GLTL1825; PRO3438; TLT-1; TLT1 |
Locus ID | 340205 |
Cytogenetics | 6p21.1 |
Summary | This gene encodes a member of the triggering receptor expressed on myeloid cells-like (TREM) family. The encoded protein is a type 1 single Ig domain orphan receptor localized to the alpha-granule membranes of platelets. The encoded protein is involved in platelet aggregation, inflammation, and cellular activation and has been linked to Gray platelet syndrome. Alternative splicing results in multiple transcript variants [provided by RefSeq, Nov 2012] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406014 | TREML1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406014 | Transient overexpression lysate of triggering receptor expressed on myeloid cells-like 1 (TREML1) |
CNY 3,080.00 |
|
TP319476 | Recombinant protein of human triggering receptor expressed on myeloid cells-like 1 (TREML1), 20 µg |
CNY 2,900.00 |
|
TP720334 | Recombinant protein of human triggering receptor expressed on myeloid cells-like 1 (TREML1) |
CNY 3,140.00 |