TREML1 (NM_178174) Human Recombinant Protein
CAT#: TP319476
Recombinant protein of human triggering receptor expressed on myeloid cells-like 1 (TREML1), 20 µg
View other "TREML1" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219476 representing NM_178174
Red=Cloning site Green=Tags(s) MGLTLLLLLLLGLEGQGIVGSLPEVLQAPVGSSILVQCHYRLQDVKAQKVWCRFLPEGCQPLVSSAVDRR APAGRRTFLTDLGGGLLQVEMVTLQEEDAGEYGCMVDGARGPQILHRVSLNILPPEEEEETHKIGSLAEN AFSDPAGSANPLEPSQDEKSIPLIWGAVLLVGLLVAAVVLFAVMAKRKQGNRLGVCGRFLSSRVSGMNPS SVVHHVSDSGPAAELPLDVPHIRLDSPPSFDNTTYTSLPLDSPSGKPSLPAPSSLPPLPPKVLVCSKPVT YATVIFPGGNKGGGTSCGPAQNPPNNQTPSS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 32.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_835468 |
Locus ID | 340205 |
UniProt ID | Q86YW5 |
Refseq Size | 980 |
Cytogenetics | 6p21.1 |
Refseq ORF | 933 |
Synonyms | dJ238O23.3; GLTL1825; PRO3438; TLT-1; TLT1 |
Summary | This gene encodes a member of the triggering receptor expressed on myeloid cells-like (TREM) family. The encoded protein is a type 1 single Ig domain orphan receptor localized to the alpha-granule membranes of platelets. The encoded protein is involved in platelet aggregation, inflammation, and cellular activation and has been linked to Gray platelet syndrome. Alternative splicing results in multiple transcript variants [provided by RefSeq, Nov 2012] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406014 | TREML1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406014 | Transient overexpression lysate of triggering receptor expressed on myeloid cells-like 1 (TREML1) |
CNY 3,080.00 |
|
PH319476 | TREML1 MS Standard C13 and N15-labeled recombinant protein (NP_835468) |
CNY 19,520.00 |
|
TP720334 | Recombinant protein of human triggering receptor expressed on myeloid cells-like 1 (TREML1) |
CNY 1,800.00 |