COASY (NM_025233) Human Mass Spec Standard
CAT#: PH320733
COASY MS Standard C13 and N15-labeled recombinant protein (NP_079509)
View other "COASY" proteins (15)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
Product Data | |
Description | COASY MS Standard C13 and N15-labeled recombinant protein (NP_079509) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220733 |
Predicted MW | 62.1 kDa |
Protein Sequence |
>RC220733 representing NM_025233
Red=Cloning site Green=Tags(s) MAVFRSGLLVLTTPLASLAPRLASILTSAARLVNHTLYVHLQPGMSLEGPAQPQYSPVQATFEVLDFITH LYAGADVHRHLDVRILLTNIRTKSTFLPPLPTSVQNLAHPPEVVLTDFQTLDGSQYNPVKQQLVRYATSC YSCCPRLASVLLYSDYGIGEVPVEPLDVPLPSTIRPASPVAGSPKQPVRGYYRGAVGGTFDRLHNAHKVL LSVACILAQEQLVVGVADKDLLKSKLLPELLQPYTERVEHLSEFLVDIKPSLTFDVIPLLDPYGPAGSDP SLEFLVVSEETYRGGMAINRFRLENDLEELALYQIQLLKDLRHTENEEDKVSSSSFRQRMLGNLLRPPYE RPELPTCLYVIGLTGISGSGKSSIAQRLKGLGAFVIDSDHLGHRAYAPGGPAYQPVVEAFGTDILHKDGI INRKVLGSRVFGNKKQLKILTDIMWPIIAKLAREEMDRAVAEGKRVCVIDAAVLLEAGWQNLVHEVWTAV IPETEAVRRIVERDGLSEAAAQSRLQSQMSGQQLVEQSHVVLSTLWEPHITQRQVEKAWALLQKRIPKTH QALD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_079509 |
RefSeq Size | 2470 |
RefSeq ORF | 1692 |
Synonyms | DPCK; NBIA6; NBP; PCH12; pOV-2; PPAT; UKR1 |
Locus ID | 80347 |
Cytogenetics | 17q21.2 |
Summary | Coenzyme A (CoA) functions as a carrier of acetyl and acyl groups in cells and thus plays an important role in numerous synthetic and degradative metabolic pathways in all organisms. In eukaryotes, CoA and its derivatives are also involved in membrane trafficking and signal transduction. This gene encodes the bifunctional protein coenzyme A synthase (CoAsy) which carries out the last two steps in the biosynthesis of CoA from pantothenic acid (vitamin B5). The phosphopantetheine adenylyltransferase domain of this bifunctional protein catalyzes the conversion of 4'-phosphopantetheine into dephospho-coenzyme A (dpCoA) while its dephospho-CoA kinase domain completes the final step by phosphorylating dpCoA to form CoA. Mutations in this gene are associated with neurodegeneration with brain iron accumulation (NBIA). Alternative splicing results in multiple isoforms. [provided by RefSeq, Apr 2014] |
Protein Pathways | Metabolic pathways, Pantothenate and CoA biosynthesis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403068 | COASY HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420963 | COASY HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC420964 | COASY HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC425766 | COASY HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC425767 | COASY HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403068 | Transient overexpression lysate of Coenzyme A synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3,080.00 |
|
LY420963 | Transient overexpression lysate of Coenzyme A synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 4,840.00 |
|
LY420964 | Transient overexpression lysate of Coenzyme A synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 3 |
CNY 3,080.00 |
|
LY425767 | Transient overexpression lysate of Coenzyme A synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 3 |
CNY 3,080.00 |
|
PH309424 | COASY MS Standard C13 and N15-labeled recombinant protein (NP_001035995) |
CNY 19,520.00 |
|
PH315228 | COASY MS Standard C13 and N15-labeled recombinant protein (NP_001035994) |
CNY 19,520.00 |
|
TP309424 | Recombinant protein of human Coenzyme A synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP315228 | Recombinant protein of human Coenzyme A synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP315287 | Recombinant protein of human Coenzyme A synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 5, 20 µg |
CNY 2,900.00 |
|
TP320733 | Recombinant protein of human Coenzyme A synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg |
CNY 2,900.00 |