SOCS1 (NM_003745) Human Mass Spec Standard
CAT#: PH320847
SOCS1 MS Standard C13 and N15-labeled recombinant protein (NP_003736)
View other "SOCS1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SOCS1 MS Standard C13 and N15-labeled recombinant protein (NP_003736) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220847 |
Predicted MW | 23.4 kDa |
Protein Sequence |
>RC220847 representing NM_003745
Red=Cloning site Green=Tags(s) MVAHNQVAADNAVSTAAEPRRRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRSHADYRRITRA SALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGS RESFDCLFELLEHYVAAPRRMLGAPLRQRRVRPLQELCRQRIVATVGRENLARIPLNPVLRDYLSSFPFQ I myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003736 |
RefSeq Size | 1216 |
RefSeq ORF | 633 |
Synonyms | AISIMD; CIS1; CISH1; JAB; SOCS-1; SSI-1; SSI1; TIP-3; TIP3 |
Locus ID | 8651 |
Cytogenetics | 16p13.13 |
Summary | This gene encodes a member of the STAT-induced STAT inhibitor (SSI), also known as suppressor of cytokine signaling (SOCS), family. SSI family members are cytokine-inducible negative regulators of cytokine signaling. The expression of this gene can be induced by a subset of cytokines, including IL2, IL3 erythropoietin (EPO), CSF2/GM-CSF, and interferon (IFN)-gamma. The protein encoded by this gene functions downstream of cytokine receptors, and takes part in a negative feedback loop to attenuate cytokine signaling. Knockout studies in mice suggested the role of this gene as a modulator of IFN-gamma action, which is required for normal postnatal growth and survival. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Stem cell - Pluripotency, Stem cell relevant signaling - JAK/STAT signaling pathway |
Protein Pathways | Insulin signaling pathway, Jak-STAT signaling pathway, Type II diabetes mellitus, Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401230 | SOCS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401230 | Transient overexpression lysate of suppressor of cytokine signaling 1 (SOCS1) |
CNY 3,080.00 |
|
TP320847 | Recombinant protein of human suppressor of cytokine signaling 1 (SOCS1), 20 µg |
CNY 2,900.00 |