Caveolin 3 (CAV3) (NM_033337) Human Mass Spec Standard
CAT#: PH321140
CAV3 MS Standard C13 and N15-labeled recombinant protein (NP_203123)
View other "Caveolin 3" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CAV3 MS Standard C13 and N15-labeled recombinant protein (NP_203123) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221140 |
Predicted MW | 17.3 kDa |
Protein Sequence |
>RC221140 protein sequence
Red=Cloning site Green=Tags(s) MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKVSYTTFTVSKY WCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHIYSLCIRTFCNPLFAALGQVC SSIKVVLRKEV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_203123 |
RefSeq Size | 1435 |
RefSeq ORF | 453 |
Synonyms | LGMD1C; LQT9; MPDT; RMD2; VIP-21; VIP21 |
Locus ID | 859 |
Cytogenetics | 3p25.3 |
Summary | This gene encodes a caveolin family member, which functions as a component of the caveolae plasma membranes found in most cell types. Caveolin proteins are proposed to be scaffolding proteins for organizing and concentrating certain caveolin-interacting molecules. Mutations identified in this gene lead to interference with protein oligomerization or intra-cellular routing, disrupting caveolae formation and resulting in Limb-Girdle muscular dystrophy type-1C (LGMD-1C), hyperCKemia or rippling muscle disease (RMD). Alternative splicing has been identified for this locus, with inclusion or exclusion of a differentially spliced intron. In addition, transcripts utilize multiple polyA sites and contain two potential translation initiation sites. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Focal adhesion |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409590 | CAV3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420058 | CAV3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409590 | Transient overexpression lysate of caveolin 3 (CAV3), transcript variant 1 |
CNY 3,080.00 |
|
LY420058 | Transient overexpression lysate of caveolin 3 (CAV3), transcript variant 2 |
CNY 3,080.00 |
|
TP321140 | Recombinant protein of human caveolin 3 (CAV3), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它Caveolin 3产品