CPNE1 (NM_152926) Human Mass Spec Standard
CAT#: PH321253
CPNE1 MS Standard C13 and N15-labeled recombinant protein (NP_690903)
View other "CPNE1" proteins (16)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | CPNE1 MS Standard C13 and N15-labeled recombinant protein (NP_690903) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221253 |
Predicted MW | 58.9 kDa |
Protein Sequence |
>RC221253 representing NM_152926
Red=Cloning site Green=Tags(s) MAHCVTLVQLSISCDHLIDKDIGSKSDPLCVLLQDVGGGSWAELGRTERVRNCSSPEFSKTLQLEYRFET VQKLRFGIYDIDNKTPELRDDDFLGGAECSLGQIVSSQVLTLPLMLKPGKPAGRGTITVSAQELKDNRVV TMEVEARNLDKKDFLGKSDPFLEFFRQGDGKWHLVYRSEVIKNNLNPTWKRFSVPVQHFCGGNPSTPIQV QCSDYDSDGSHDLIGTFHTSLAQLQAVPAEFECIHPEKQQKKKSYKNSGTIRVKICRVETEYSFLDYVMG GCQINFTVGVDFTGSNGDPSSPDSLHYLSPTGVNEYLMALWSVGSVVQDYDSDKLFPAFGFGAQVPPDWQ VSHEFALNFNPSNPYCAGIQGIVDAYRQALPQVRLYGPTNFAPIINHVARFAAQAAHQGTASQYFMLLLL TDGAVTDVEATREAVVRASNLPMSVIIVGVGGADFEAMEQLDADGGPLHTRSGQAAARDIVQFVPYRRFQ NAPREALAQTVLAEVPTQLVSYFRAQGWAPLKPLPPSAKDPAQAPQA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_690903 |
RefSeq Size | 1954 |
RefSeq ORF | 1611 |
Synonyms | COPN1; CPN1 |
Locus ID | 8904 |
Cytogenetics | 20q11.22 |
Summary | Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene encodes a calcium-dependent protein that also contains two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. However, the encoded protein does not contain a predicted signal sequence or transmembrane domains. This protein has a broad tissue distribution and it may function in membrane trafficking. This gene and the gene for RNA binding motif protein 12 overlap at map location 20q11.21. Alternate splicing results in multiple transcript variants encoding different proteins. [provided by RefSeq, Aug 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407221 | CPNE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC407223 | CPNE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC407224 | CPNE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407221 | Transient overexpression lysate of copine I (CPNE1), transcript variant 2 |
CNY 3,080.00 |
|
LY407223 | Transient overexpression lysate of copine I (CPNE1), transcript variant 5 |
CNY 3,080.00 |
|
LY407224 | Transient overexpression lysate of copine I (CPNE1), transcript variant 6 |
CNY 3,080.00 |
|
PH312736 | CPNE1 MS Standard C13 and N15-labeled recombinant protein (NP_690905) |
CNY 14,250.00 |
|
PH312892 | CPNE1 MS Standard C13 and N15-labeled recombinant protein (NP_690902) |
CNY 14,250.00 |
|
PH321043 | CPNE1 MS Standard C13 and N15-labeled recombinant protein (NP_690906) |
CNY 19,520.00 |
|
PH323828 | CPNE1 MS Standard C13 and N15-labeled recombinant protein (NP_690904) |
CNY 14,250.00 |
|
TP312736 | Purified recombinant protein of Homo sapiens copine I (CPNE1), transcript variant 5, 20 µg |
CNY 2,900.00 |
|
TP312892 | Purified recombinant protein of Homo sapiens copine I (CPNE1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP321043 | Recombinant protein of human copine I (CPNE1), transcript variant 6, 20 µg |
CNY 2,900.00 |
|
TP321253 | Purified recombinant protein of Homo sapiens copine I (CPNE1), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP323828 | Purified recombinant protein of Homo sapiens copine I (CPNE1), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
TP721021 | Purified recombinant protein of Human copine I (CPNE1), transcript variant 5 |
CNY 3,140.00 |