United States
Germany
Japan
United Kingdom
China
Kallikrein 6 (KLK6) (NM_001012965) Human Mass Spec Standard
CAT＃: PH321436
KLK6 MS Standard C13 and N15-labeled recombinant protein (NP_001012983)
View other "Kallikrein 6" proteins (12)
|
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Product images
Specifications
| Product Data | |
| Description | KLK6 MS Standard C13 and N15-labeled recombinant protein (NP_001012983) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC221436 |
| Predicted MW | 26.86 kDa |
| Protein Sequence |
>RC221436 representing NM_001012965
Red=Cloning site Green=Tags(s) MKKLMVVLSLIAAAWAEEQNKLVHGGPCDKTSHPYQAALYTSGHLLCGGVLIHPLWVLTAAHCKKPNLQV FLGKHNLRQRESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSELIQPLPLERDCSANTTSCHI LGWGKTADGDFPDTIQCAYIHLVSREECEHAYPGQITQNMLCAGDEKYGKDSCQGDSGGPLVCGDHLRGL VSWGNIPCGSKEKPGVYTNVCRYTNWIQKTIQAK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001012983 |
| RefSeq Size | 1495 |
| RefSeq ORF | 732 |
| Synonyms | Bssp; hK6; Klk7; PRSS9; PRSS18; SP59 |
| Locus ID | 5653 |
| Cytogenetics | 19q13.41 |
| Summary | This gene encodes a member of the kallikrein subfamily of the peptidase S1 family of serine proteases. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. The encoded preproprotein is proteolytically processed to generate the mature protease. Expression of this protease is regulated by steroid hormones and may be elevated in multiple human cancers and in serum from psoriasis patients. The encoded protease may participate in the cleavage of amyloid precursor protein and alpha-synuclein, thus implicating this protease in Alzheimer's and Parkinson's disease, respectively. This gene is located in a gene cluster on chromosome 19. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Feb 2016] |
| Protein Families | Druggable Genome, Protease, Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400982 | KLK6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422842 | KLK6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422843 | KLK6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400982 | Transient overexpression lysate of kallikrein-related peptidase 6 (KLK6), transcript variant A |
CNY 3,080.00 |
|
| LY422842 | Transient overexpression lysate of kallikrein-related peptidase 6 (KLK6), transcript variant B |
CNY 3,080.00 |
|
| LY422843 | Transient overexpression lysate of kallikrein-related peptidase 6 (KLK6), transcript variant C |
CNY 3,080.00 |
|
| PH302146 | KLK6 MS Standard C13 and N15-labeled recombinant protein (NP_001012982) |
CNY 14,250.00 |
|
| PH318647 | KLK6 MS Standard C13 and N15-labeled recombinant protein (NP_002765) |
CNY 19,520.00 |
|
| TP302146 | Purified recombinant protein of Homo sapiens kallikrein-related peptidase 6 (KLK6), transcript variant B, 20 µg |
CNY 2,900.00 |
|
| TP318647 | Recombinant protein of human kallikrein-related peptidase 6 (KLK6), transcript variant A, 20 µg |
CNY 2,900.00 |
|
| TP321436 | Purified recombinant protein of Homo sapiens kallikrein-related peptidase 6 (KLK6), transcript variant C, 20 µg |
CNY 2,900.00 |
|
| TP720315 | Recombinant protein of human kallikrein-related peptidase 6 (KLK6), transcript variant B |
CNY 3,140.00 |
其它Kallikrein 6产品
