CD1 (CD1A) (NM_001763) Human Mass Spec Standard
CAT#: PH321599
CD1A MS Standard C13 and N15-labeled recombinant protein (NP_001754)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CD1A MS Standard C13 and N15-labeled recombinant protein (NP_001754) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221599 |
Predicted MW | 37.17 kDa |
Protein Sequence |
>RC221599 representing NM_001763
Red=Cloning site Green=Tags(s) MLFLLLPLLAVLPGDGNADGLKEPLSFHVIWIASFYNHSWKQNLVSGWLSDLQTHTWDSNSSTIVFLWPW SRGNFSNEEWKELETLFRIRTIRSFEGIRRYAHELQFEYPFEIQVTGGCELHSGKVSGSFLQLAYQGSDF VSFQNNSWLPYPVAGNMAKHFCKVLNQNQHENDITHNLLSDTCPRFILGLLDAGKAHLQRQVKPEAWLSH GPSPGPGHLQLVCHVSGFYPKPVWVMWMRGEQEQQGTQRGDILPSADGTWYLRATLEVAAGEAADLSCRV KHSSLEGQDIVLYWEHHSSVGFIILAVIVPLLLLIGLALWFRKRCFC myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001754 |
RefSeq Size | 2072 |
RefSeq ORF | 981 |
Synonyms | CD1; FCB6; HTA1; R4; T6 |
Locus ID | 909 |
Cytogenetics | 1q23.1 |
Summary | This gene encodes a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene localizes to the plasma membrane and to recycling vesicles of the early endocytic system. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Hematopoietic cell lineage |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419760 | CD1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419760 | Transient overexpression lysate of CD1a molecule (CD1A) |
CNY 3,080.00 |
|
TP321599 | Recombinant protein of human CD1a molecule (CD1A), 20 µg |
CNY 2,900.00 |
|
TP700275 | Purified Recombinant protein of Human CD1a molecule (CD1A), with C-terminal Fc tag, expressed in human cells, 20 µg |
CNY 6,650.00 |