United States
Germany
Japan
United Kingdom
China
beta Arrestin 1 (ARRB1) (NM_020251) Human Mass Spec Standard
CAT＃: PH321737
ARRB1 MS Standard C13 and N15-labeled recombinant protein (NP_064647)
View other "beta Arrestin 1" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Product images
CNY 1,999.00
CNY 3,600.00
CNY 3,080.00
Specifications
| Product Data | |
| Description | ARRB1 MS Standard C13 and N15-labeled recombinant protein (NP_064647) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC221737 |
| Predicted MW | 46.1 kDa |
| Protein Sequence |
>RC221737 representing NM_020251
Red=Cloning site Green=Tags(s) MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDV LGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKAC GVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYH GEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLAN NREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGDVAVELPFTLMHPKPKE EPPHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_064647 |
| RefSeq Size | 2180 |
| RefSeq ORF | 1230 |
| Synonyms | ARB1; ARR1 |
| Locus ID | 408 |
| Cytogenetics | 11q13.4 |
| Summary | Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. Arrestin beta 1 is a cytosolic protein and acts as a cofactor in the beta-adrenergic receptor kinase (BARK) mediated desensitization of beta-adrenergic receptors. Besides the central nervous system, it is expressed at high levels in peripheral blood leukocytes, and thus the BARK/beta-arrestin system is believed to play a major role in regulating receptor-mediated immune functions. Alternatively spliced transcripts encoding different isoforms of arrestin beta 1 have been described. [provided by RefSeq, Jan 2011] |
| Protein Families | Druggable Genome |
| Protein Pathways | Chemokine signaling pathway, Endocytosis, MAPK signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412547 | ARRB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC418298 | ARRB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429613 | ARRB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412547 | Transient overexpression lysate of arrestin, beta 1 (ARRB1), transcript variant 2 |
CNY 3,080.00 |
|
| LY418298 | Transient overexpression lysate of arrestin, beta 1 (ARRB1), transcript variant 1 |
CNY 3,080.00 |
|
| TP321737 | Purified recombinant protein of Homo sapiens arrestin, beta 1 (ARRB1), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP720083 | Recombinant protein of human arrestin, beta 1 (ARRB1), transcript variant 1 |
CNY 3,140.00 |
|
| TP762120 | Purified recombinant protein of Human arrestin, beta 1 (ARRB1), transcript variant 1,full length, with N-terminal His tag, expressed in E. coli, 50ug |
CNY 1,948.00 |
其它beta Arrestin 1产品
