PAX5 (NM_016734) Human Mass Spec Standard
CAT#: PH322785
PAX5 MS Standard C13 and N15-labeled recombinant protein (NP_057953)
View other "PAX5" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | PAX5 MS Standard C13 and N15-labeled recombinant protein (NP_057953) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC222785 |
Predicted MW | 42 kDa |
Protein Sequence |
>RC222785 representing NM_016734
Red=Cloning site Green=Tags(s) MDLEKNYPTPRTSRTGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILG RYYETGSIKPGVIGGSKPKVATPKVVEKIAEYKRQNPTMFAWEIRDRLLAERVCDNDTVPSVSSINRIIR TKVQQPPNQPVPASSHSIVSTGSVTQVSSVSTDSAGSSYSISGILGITSPSADTNKRKRDEGIQESPVPN GHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQTTEYSAMASLAGGLDDMKAN LASPTPADIGSSVPGPQSYPIVTGRDLASTTLPGYPPHVPPAGQGSYSAPTLTGMVPGSEFSGSPYSHPQ YSSYNDSWRFPNPGLLGSPYYYSAAARGAAPPAAATAYDRH myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057953 |
RefSeq Size | 3650 |
RefSeq ORF | 1173 |
Synonyms | ALL3; BSAP |
Locus ID | 5079 |
Cytogenetics | 9p13.2 |
Summary | This gene encodes a member of the paired box (PAX) family of transcription factors. The central feature of this gene family is a novel, highly conserved DNA-binding motif, known as the paired box. Paired box transcription factors are important regulators in early development, and alterations in the expression of their genes are thought to contribute to neoplastic transformation. This gene encodes the B-cell lineage specific activator protein that is expressed at early, but not late stages of B-cell differentiation. Its expression has also been detected in developing CNS and testis and so the encoded protein may also play a role in neural development and spermatogenesis. This gene is located at 9p13, which is involved in t(9;14)(p13;q32) translocations recurring in small lymphocytic lymphomas of the plasmacytoid subtype, and in derived large-cell lymphomas. This translocation brings the potent E-mu enhancer of the IgH gene into close proximity of the PAX5 promoter, suggesting that the deregulation of transcription of this gene contributes to the pathogenesis of these lymphomas. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2013] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413830 | PAX5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413830 | Transient overexpression lysate of paired box 5 (PAX5) |
CNY 3,080.00 |
|
TP322785 | Recombinant protein of human paired box 5 (PAX5), 20 µg |
CNY 2,900.00 |
|
TP762431 | Purified recombinant protein of Human paired box 5 (PAX5), Arg239-End, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1,950.00 |