RANBP1 (NM_002882) Human Mass Spec Standard
CAT#: PH323305
RANBP1 MS Standard C13 and N15-labeled recombinant protein (NP_002873)
View other "RANBP1" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | RANBP1 MS Standard C13 and N15-labeled recombinant protein (NP_002873) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC223305 |
Predicted MW | 23.1 kDa |
Protein Sequence |
>RC223305 representing NM_002882
Red=Cloning site Green=Tags(s) MAAAKDTHEDHDTSTENTDESNHDPQFEPIVSLPEQEIKTLEEDEEELFKMRAKLFRFASENDLPEWKER GTGDVKLLKHKEKGAIRLLMRRDKTLKICANHYITPMMELKPNAGSDRAWVWNTHADFADECPKPELLAI RFLNAENAQKFKTKFEECRKEIEEREKKAGSGKNDHAEKVAEKLEALSVKEETKEDAEEKQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002873 |
RefSeq Size | 884 |
RefSeq ORF | 603 |
Synonyms | HTF9A |
Locus ID | 5902 |
Cytogenetics | 22q11.21 |
Summary | This gene encodes a protein that forms a complex with Ras-related nuclear protein (Ran) and metabolizes guanoside triphosphate (GTP). This complex participates in the regulation of the cell cycle by controlling transport of proteins and nucleic acids into the nucleus. There are multiple pseudogenes for this gene on chromosomes 9, 12, 17, and X. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401015 | RANBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401015 | Transient overexpression lysate of RAN binding protein 1 (RANBP1) |
CNY 3,080.00 |
|
TP323305 | Recombinant protein of human RAN binding protein 1 (RANBP1), 20 µg |
CNY 2,900.00 |
|
TP710020 | Recombinant protein of human v-raf-1 murine leukemia viral oncogene homolog 1 (RAF1),residues Ser306-Phe648, with N-terminal polyhistidine tag,expressed in sf9 cells |
CNY 4,020.00 |
|
TP760657 | Purified recombinant protein of Human RAN binding protein 1 (RANBP1), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |