NOR1 (NR4A3) (NM_173200) Human Mass Spec Standard
CAT#: PH323629
NR4A3 MS Standard C13 and N15-labeled recombinant protein (NP_775292)
View other "NOR1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
CNY 4,840.00
Specifications
Product Data | |
Description | NR4A3 MS Standard C13 and N15-labeled recombinant protein (NP_775292) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC223629 |
Predicted MW | 69.3 kDa |
Protein Sequence |
>RC223629 representing NM_173200
Red=Cloning site Green=Tags(s) MHDSIRFGNVDMPCVQAQYSPSPPGSSYAAQTYSSEYTTEIMNPDYTKLTMDLGSTEITATATTSLPSIS TFVEGYSSNYELKPSCVYQMQRPLIKVEEGRAPSYHHHHHHHHHHHHHHQQQHQQPSIPPASSPEDEVLP STSMYFKQSPPSTPTTPAFPPQAGALWDEALPSAPGCIAPGPLLDPPMKAVPTVAGARFPLFHFKPSPPH PPAPSPAGGHHLGYDPTAAAALSLPLGAAAAAGSQAAALESHPYGLPLAKRAAPLAFPPLGLTPSPTASS LLGESPSLPSPPSRSSSSGEGTCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKR RRNRCQYCRFQKCLSVGMVKEVVRTDSLKGRRGRLPSKPKSPLQQEPSQPSPPSPPICMMNALVRALTDS TPRDLDYSRYCPTDQAAAGTDAEHVQQFYNLLTASIDVSRSWAEKIPGFTDLPKEDQTLLIESAFLELFV LRLSIRSNTAEDKFVFCNGLVLHRLQCLRGFGEWLDSIKDFSLNLQSLNLDIQALACLSALSMITERHGL KEPKRVEELCNKITSSLKDHQSKGQALEPTESKVLGALVELRKICTLGLQRIFYLKLEDLVSPPSIIDKL FLDTLPF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_775292 |
RefSeq Size | 4983 |
RefSeq ORF | 1911 |
Synonyms | CHN; CSMF; MINOR; NOR1 |
Locus ID | 8013 |
Cytogenetics | 9q31.1 |
Summary | This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. The encoded protein may act as a transcriptional activator. The protein can efficiently bind the NGFI-B Response Element (NBRE). Three different versions of extraskeletal myxoid chondrosarcomas (EMCs) are the result of reciprocal translocations between this gene and other genes. The translocation breakpoints are associated with Nuclear Receptor Subfamily 4, Group A, Member 3 (on chromosome 9) and either Ewing Sarcome Breakpoint Region 1 (on chromosome 22), RNA Polymerase II, TATA Box-Binding Protein-Associated Factor, 68-KD (on chromosome 17), or Transcription factor 12 (on chromosome 15). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2010] |
Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406643 | NR4A3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC416280 | NR4A3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC429326 | NR4A3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406643 | Transient overexpression lysate of nuclear receptor subfamily 4, group A, member 3 (NR4A3), transcript variant 2 |
CNY 4,840.00 |
|
LY416280 | Transient overexpression lysate of nuclear receptor subfamily 4, group A, member 3 (NR4A3), transcript variant 1 |
CNY 4,840.00 |
|
LY429326 | Transient overexpression lysate of nuclear receptor subfamily 4, group A, member 3 (NR4A3), transcript variant 1 |
CNY 3,080.00 |
|
TP323629 | Recombinant protein of human nuclear receptor subfamily 4, group A, member 3 (NR4A3), transcript variant 3, 20 µg |
CNY 2,900.00 |