United States
Germany
Japan
United Kingdom
China
Sumo 2 (SUMO2) (NM_006937) Human Mass Spec Standard
CAT＃: PH324336
SUMO2 MS Standard C13 and N15-labeled recombinant protein (NP_008868)
View other "Sumo 2" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | SUMO2 MS Standard C13 and N15-labeled recombinant protein (NP_008868) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC224336 |
| Predicted MW | 10.7 kDa |
| Protein Sequence |
>RC224336 representing NM_006937
Red=Cloning site Green=Tags(s) MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINET DTPAQLEMEDEDTIDVFQQQTGGVY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_008868 |
| RefSeq Size | 1066 |
| RefSeq ORF | 285 |
| Synonyms | HSMT3; Smt3A; SMT3B; SMT3H2; SUMO3 |
| Locus ID | 6613 |
| Cytogenetics | 17q25.1 |
| Summary | This gene encodes a protein that is a member of the SUMO (small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unlike ubiquitin which targets proteins for degradation, this protein is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. It is not active until the last two amino acids of the carboxy-terminus have been cleaved off. Numerous pseudogenes have been reported for this gene. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416283 | SUMO2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423659 | SUMO2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416283 | Transient overexpression lysate of SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae) (SUMO2), transcript variant 1 |
CNY 3,080.00 |
|
| LY423659 | Transient overexpression lysate of SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae) (SUMO2), transcript variant 2 |
CNY 3,080.00 |
|
| PH322664 | SUMO2 MS Standard C13 and N15-labeled recombinant protein (NP_001005849) |
CNY 19,520.00 |
|
| TP322664 | Recombinant protein of human SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae) (SUMO2), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP324336 | Recombinant protein of human SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae) (SUMO2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP720154 | Recombinant protein of human SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae) (SUMO2), transcript variant 2 |
CNY 3,140.00 |
