Sumo 2 (SUMO2) (NM_001005849) Human Mass Spec Standard
CAT#: PH322664
SUMO2 MS Standard C13 and N15-labeled recombinant protein (NP_001005849)
View other "Sumo 2" proteins (8)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SUMO2 MS Standard C13 and N15-labeled recombinant protein (NP_001005849) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC222664 |
Predicted MW | 7.9 kDa |
Protein Sequence |
>RC222664 representing NM_001005849
Red=Cloning site Green=Tags(s) MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQLEMEDEDTIDVFQQQTGGV Y myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001005849 |
RefSeq Size | 994 |
RefSeq ORF | 213 |
Synonyms | HSMT3; Smt3A; SMT3B; SMT3H2; SUMO3 |
Locus ID | 6613 |
Cytogenetics | 17q25.1 |
Summary | This gene encodes a protein that is a member of the SUMO (small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unlike ubiquitin which targets proteins for degradation, this protein is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. It is not active until the last two amino acids of the carboxy-terminus have been cleaved off. Numerous pseudogenes have been reported for this gene. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416283 | SUMO2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423659 | SUMO2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416283 | Transient overexpression lysate of SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae) (SUMO2), transcript variant 1 |
CNY 3,080.00 |
|
LY423659 | Transient overexpression lysate of SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae) (SUMO2), transcript variant 2 |
CNY 3,080.00 |
|
PH324336 | SUMO2 MS Standard C13 and N15-labeled recombinant protein (NP_008868) |
CNY 19,520.00 |
|
TP322664 | Recombinant protein of human SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae) (SUMO2), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP324336 | Recombinant protein of human SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae) (SUMO2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP720154 | Recombinant protein of human SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae) (SUMO2), transcript variant 2 |
CNY 3,140.00 |