ASPA (NM_001128085) Human Mass Spec Standard
CAT#: PH325443
ASPA MS Standard C13 and N15-labeled recombinant protein (NP_001121557)
View other "ASPA" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
Product Data | |
Description | ASPA MS Standard C13 and N15-labeled recombinant protein (NP_001121557) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC225443 |
Predicted MW | 35.7 kDa |
Protein Sequence |
>RC225443 protein sequence
Red=Cloning site Green=Tags(s) MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLN RIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMF HYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFN EGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYP VFVNEAAYYEKKEAFAKTTKLTLNAKSIRCCLH myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001121557 |
RefSeq Size | 1368 |
RefSeq ORF | 939 |
Synonyms | ACY2; ASP |
Locus ID | 443 |
Cytogenetics | 17p13.2 |
Summary | This gene encodes an enzyme that catalyzes the conversion of N-acetyl_L-aspartic acid (NAA) to aspartate and acetate. NAA is abundant in the brain where hydrolysis by aspartoacylase is thought to help maintain white matter. This protein is an NAA scavenger in other tissues. Mutations in this gene cause Canavan disease. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Alanine, aspartate and glutamate metabolism, Histidine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424954 | ASPA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426889 | ASPA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424954 | Transient overexpression lysate of aspartoacylase (Canavan disease) (ASPA), transcript variant 1 |
CNY 3,080.00 |
|
LY426889 | Transient overexpression lysate of aspartoacylase (Canavan disease) (ASPA), transcript variant 2 |
CNY 3,080.00 |
|
PH306564 | ASPA MS Standard C13 and N15-labeled recombinant protein (NP_000040) |
CNY 19,520.00 |
|
TP306564 | Recombinant protein of human aspartoacylase (Canavan disease) (ASPA), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP325443 | Recombinant protein of human aspartoacylase (Canavan disease) (ASPA), transcript variant 2, 20 µg |
CNY 2,900.00 |