ASPA (NM_001128085) Human Recombinant Protein
CAT#: TP325443
Recombinant protein of human aspartoacylase (Canavan disease) (ASPA), transcript variant 2, 20 µg
View other "ASPA" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225443 protein sequence
Red=Cloning site Green=Tags(s) MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLN RIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMF HYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFN EGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYP VFVNEAAYYEKKEAFAKTTKLTLNAKSIRCCLH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 35.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001121557 |
Locus ID | 443 |
UniProt ID | P45381, Q6FH48 |
Refseq Size | 1368 |
Cytogenetics | 17p13.2 |
Refseq ORF | 939 |
Synonyms | ACY2; ASP |
Summary | This gene encodes an enzyme that catalyzes the conversion of N-acetyl_L-aspartic acid (NAA) to aspartate and acetate. NAA is abundant in the brain where hydrolysis by aspartoacylase is thought to help maintain white matter. This protein is an NAA scavenger in other tissues. Mutations in this gene cause Canavan disease. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Alanine, aspartate and glutamate metabolism, Histidine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424954 | ASPA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426889 | ASPA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424954 | Transient overexpression lysate of aspartoacylase (Canavan disease) (ASPA), transcript variant 1 |
CNY 3,080.00 |
|
LY426889 | Transient overexpression lysate of aspartoacylase (Canavan disease) (ASPA), transcript variant 2 |
CNY 3,080.00 |
|
PH306564 | ASPA MS Standard C13 and N15-labeled recombinant protein (NP_000040) |
CNY 19,520.00 |
|
PH325443 | ASPA MS Standard C13 and N15-labeled recombinant protein (NP_001121557) |
CNY 19,520.00 |
|
TP306564 | Recombinant protein of human aspartoacylase (Canavan disease) (ASPA), transcript variant 1, 20 µg |
CNY 2,900.00 |