KLC2 (NM_001134776) Human Mass Spec Standard
CAT#: PH326035
KLC2 MS Standard C13 and N15-labeled recombinant protein (NP_001128248)
View other "KLC2" proteins (13)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
Product Data | |
Description | KLC2 MS Standard C13 and N15-labeled recombinant protein (NP_001128248) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC226035 |
Predicted MW | 68.9 kDa |
Protein Sequence |
>RC226035 protein sequence
Red=Cloning site Green=Tags(s) MAMMVFPREEKLSQDEIVLGTKAVIQGLETLRGEHRALLAPLVAPEAGEAEPGSQERCILLRRSLEAIEL GLGEAQVILALSSHLGAVESEKQKLRAQVRRLVQENQWLREELAGTQQKLQRSEQAVAQLEEEKQHLLFM SQIRKLDEDASPNEEKGDVPKDTLDDLFPNEDEQSPAPSPGGGDVSGQHGGYEIPARLRTLHNLVIQYAS QGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALAIREKTLGKDHPA VAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKFHPDVAKQLSNLALLCQNQGKAEEVEYYYRRA LEIYATRLGPDDPNVAKTKNNLASCYLKQGKYQDAETLYKEILTRAHEKEFGSVNGDNKPIWMHAEEREE SKDKRRDSAPYGEYGSWYKACKVDSPTVNTTLRSLGALYRRQGKLEAAHTLEDCASRNRKQGLDPASQTK VVELLKDGSGRRGDRRSSRDMAGGAGPRSESDLEDVGPTAEWNGDGSGSLRRSGSFGKLRDALRRSSEML VKKLQGGTPQEPPNPRMKRASSLNFLNKSVEEPTQPGGTGLSDSRTLSSSSMDLSRRSSLVG myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001128248 |
RefSeq Size | 2972 |
RefSeq ORF | 1866 |
Locus ID | 64837 |
Cytogenetics | 11q13.2 |
Summary | The protein encoded by this gene is a light chain of kinesin, a molecular motor responsible for moving vesicles and organelles along microtubules. Defects in this gene are a cause of spastic paraplegia, optic atrophy, and neuropathy (SPOAN) syndrome. [provided by RefSeq, Mar 2016] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402950 | KLC2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427490 | KLC2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427491 | KLC2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427492 | KLC2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402950 | Transient overexpression lysate of kinesin light chain 2 (KLC2), transcript variant 1 |
CNY 3,080.00 |
|
LY427490 | Transient overexpression lysate of kinesin light chain 2 (KLC2), transcript variant 2 |
CNY 3,080.00 |
|
LY427491 | Transient overexpression lysate of kinesin light chain 2 (KLC2), transcript variant 3 |
CNY 3,080.00 |
|
LY427492 | Transient overexpression lysate of kinesin light chain 2 (KLC2), transcript variant 4 |
CNY 3,080.00 |
|
PH314206 | KLC2 MS Standard C13 and N15-labeled recombinant protein (NP_073733) |
CNY 19,520.00 |
|
PH326034 | KLC2 MS Standard C13 and N15-labeled recombinant protein (NP_001128247) |
CNY 19,520.00 |
|
TP314206 | Recombinant protein of human kinesin light chain 2 (KLC2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP326034 | Recombinant protein of human kinesin light chain 2 (KLC2), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP326035 | Recombinant protein of human kinesin light chain 2 (KLC2), transcript variant 4, 20 µg |
CNY 2,900.00 |