United States
Germany
Japan
United Kingdom
China
Mortality Factor 4 like 2 (MORF4L2) (NM_001142421) Human Mass Spec Standard
CAT＃: PH326678
MORF4L2 MS Standard C13 and N15-labeled recombinant protein (NP_001135893)
View other "Mortality Factor 4 like 2" proteins (14)
|
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Product images
Specifications
| Product Data | |
| Description | MORF4L2 MS Standard C13 and N15-labeled recombinant protein (NP_001135893) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC226678 |
| Predicted MW | 32.3 kDa |
| Protein Sequence |
>RC226678 protein sequence
Red=Cloning site Green=Tags(s) MSSRKQGSQPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKNLEPALPGRWGGRSAENPPSG SVRKTRKNKQKTPGNGDGGSTSEAPQPPRKKRARADPTVESEEAFKNRMEVKVKIPEELKPWLVEDWDLV TRQKQLFQLPAKKNVDAILEEYANCKKSQGNVDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEI LLAHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVAS AEYHRKAL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001135893 |
| RefSeq Size | 1929 |
| RefSeq ORF | 864 |
| Synonyms | MORFL2; MRGX |
| Locus ID | 9643 |
| Cytogenetics | Xq22.2 |
| Summary | Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage. Also component of the MSIN3A complex which acts to repress transcription by deacetylation of nucleosomal histones.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402188 | MORF4L2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428080 | MORF4L2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402188 | Transient overexpression lysate of mortality factor 4 like 2 (MORF4L2), transcript variant 2 |
CNY 3,080.00 |
|
| LY428080 | Transient overexpression lysate of mortality factor 4 like 2 (MORF4L2), transcript variant 1 |
CNY 3,080.00 |
|
| PH310566 | MORF4L2 MS Standard C13 and N15-labeled recombinant protein (NP_036418) |
CNY 19,520.00 |
|
| PH326523 | MORF4L2 MS Standard C13 and N15-labeled recombinant protein (NP_001135890) |
CNY 14,250.00 |
|
| PH326563 | MORF4L2 MS Standard C13 and N15-labeled recombinant protein (NP_001135891) |
CNY 14,250.00 |
|
| PH326622 | MORF4L2 MS Standard C13 and N15-labeled recombinant protein (NP_001135892) |
CNY 14,250.00 |
|
| TP310566 | Recombinant protein of human mortality factor 4 like 2 (MORF4L2), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP326523 | Purified recombinant protein of Homo sapiens mortality factor 4 like 2 (MORF4L2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP326563 | Purified recombinant protein of Homo sapiens mortality factor 4 like 2 (MORF4L2), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP326622 | Purified recombinant protein of Homo sapiens mortality factor 4 like 2 (MORF4L2), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
| TP326678 | Purified recombinant protein of Homo sapiens mortality factor 4 like 2 (MORF4L2), transcript variant 5, 20 µg |
CNY 2,900.00 |
|
| TP720543 | Recombinant protein of human mortality factor 4 like 2 (MORF4L2), transcript variant 1 |
CNY 3,140.00 |
其它Mortality Factor 4 like 2产品
