United States
Germany
Japan
United Kingdom
China
FLYWCH2 (NM_001142499) Human Mass Spec Standard
CAT＃: PH326732
FLYWCH2 MS Standard C13 and N15-labeled recombinant protein (NP_001135971)
View other "FLYWCH2" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
| Product Data | |
| Description | FLYWCH2 MS Standard C13 and N15-labeled recombinant protein (NP_001135971) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC226732 |
| Predicted MW | 14.6 kDa |
| Protein Sequence |
>RC226732 protein sequence
Red=Cloning site Green=Tags(s) MPLPEPSEQEGESVKASQEPSPKPGTEVIPAAPRKPRKFSKLVLLTASKDSTKVAGAKRKGVHCVMSLGV PGPATLAKALLQTHPEAQRAIEAAPQEPEQKRSRQDPGTDRTEDSGLAAGPPEAAGENFAPCSVAPGKSL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001135971 |
| RefSeq Size | 950 |
| RefSeq ORF | 420 |
| Locus ID | 114984 |
| Cytogenetics | 16p13.3 |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408693 | FLYWCH2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428133 | FLYWCH2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428134 | FLYWCH2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408693 | Transient overexpression lysate of FLYWCH family member 2 (FLYWCH2), transcript variant 1 |
CNY 3,080.00 |
|
| LY428133 | Transient overexpression lysate of FLYWCH family member 2 (FLYWCH2), transcript variant 2 |
CNY 3,080.00 |
|
| LY428134 | Transient overexpression lysate of FLYWCH family member 2 (FLYWCH2), transcript variant 3 |
CNY 3,080.00 |
|
| PH304275 | FLYWCH2 MS Standard C13 and N15-labeled recombinant protein (NP_612448) |
CNY 19,520.00 |
|
| PH326791 | FLYWCH2 MS Standard C13 and N15-labeled recombinant protein (NP_001135972) |
CNY 19,520.00 |
|
| TP304275 | Recombinant protein of human FLYWCH family member 2 (FLYWCH2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP326732 | Recombinant protein of human FLYWCH family member 2 (FLYWCH2), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP326791 | Recombinant protein of human FLYWCH family member 2 (FLYWCH2), transcript variant 3, 20 µg |
CNY 2,900.00 |
其它FLYWCH2产品
