FLYWCH2 (NM_001142500) Human Recombinant Protein
CAT#: TP326791
Recombinant protein of human FLYWCH family member 2 (FLYWCH2), transcript variant 3, 20 µg
View other "FLYWCH2" proteins (11)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC226791 protein sequence
Red=Cloning site Green=Tags(s) MPLPEPSEQEGESVKASQEPSPKPGTEVIPAAPRKPRKFSKLVLLTASKDSTKVAGAKRKGVHCVMSLGV PGPATLAKALLQTHPEAQRAIEAAPQEPEQKRSRQDPGTDRTEDSGLAAGPPEAAGENFAPCSVAPGKSL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001135972 |
Locus ID | 114984 |
UniProt ID | Q96CP2 |
Refseq Size | 1040 |
Cytogenetics | 16p13.3 |
Refseq ORF | 420 |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408693 | FLYWCH2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428133 | FLYWCH2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428134 | FLYWCH2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408693 | Transient overexpression lysate of FLYWCH family member 2 (FLYWCH2), transcript variant 1 |
CNY 3,080.00 |
|
LY428133 | Transient overexpression lysate of FLYWCH family member 2 (FLYWCH2), transcript variant 2 |
CNY 3,080.00 |
|
LY428134 | Transient overexpression lysate of FLYWCH family member 2 (FLYWCH2), transcript variant 3 |
CNY 3,080.00 |
|
PH304275 | FLYWCH2 MS Standard C13 and N15-labeled recombinant protein (NP_612448) |
CNY 19,520.00 |
|
PH326732 | FLYWCH2 MS Standard C13 and N15-labeled recombinant protein (NP_001135971) |
CNY 19,520.00 |
|
PH326791 | FLYWCH2 MS Standard C13 and N15-labeled recombinant protein (NP_001135972) |
CNY 19,520.00 |
|
TP304275 | Recombinant protein of human FLYWCH family member 2 (FLYWCH2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP326732 | Recombinant protein of human FLYWCH family member 2 (FLYWCH2), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它FLYWCH2产品