United States
Germany
Japan
United Kingdom
China
EB2 (MAPRE2) (NM_001143827) Human Mass Spec Standard
CAT＃: PH326779
MAPRE2 MS Standard C13 and N15-labeled recombinant protein (NP_001137299)
|
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
| Product Data | |
| Description | MAPRE2 MS Standard C13 and N15-labeled recombinant protein (NP_001137299) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC226779 |
| Predicted MW | 35.6 kDa |
| Protein Sequence |
>RC226779 representing NM_001143827
Red=Cloning site Green=Tags(s) MKQNRDQKCPVSQRNSSFQQPGRKPGCSSWGMAVNVYSTSITQETMSRHDIIAWVNDIVSLNYTKVEQLC SGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKLLQASFKRMNVDKVIPVEKLVKGRFQDNLDFIQ WFKKFYDANYDGKEYDPVEARQGQDAIPPPDPGEQIFNLPKKSHHANSPTAGAAKSSPAAKPGSTPSRPS SAKRASSSGSASKSDKDLETQVIQLNEQVHSLKLALEGVEKERDFYFGKLREIELLCQEHGQENDDLVQR LMDILYASEEHEGHTEEPEAEEQAHEQQPPQQEEY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001137299 |
| RefSeq ORF | 945 |
| Synonyms | CSCSC2; EB1; EB2; RP1 |
| Locus ID | 10982 |
| Cytogenetics | 18q12.1-q12.2 |
| Summary | The protein encoded by this gene shares significant homology to the adenomatous polyposis coli (APC) protein-binding EB1 gene family. This protein is a microtubule-associated protein that is necessary for spindle symmetry during mitosis. It is thought to play a role in the tumorigenesis of colorectal cancers and the proliferative control of normal cells. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jan 2012] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415395 | MAPRE2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428369 | MAPRE2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428370 | MAPRE2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415395 | Transient overexpression lysate of microtubule-associated protein, RP/EB family, member 2 (MAPRE2), transcript variant 1 |
CNY 3,080.00 |
|
| LY428369 | Transient overexpression lysate of microtubule-associated protein, RP/EB family, member 2 (MAPRE2), transcript variant 2 |
CNY 3,080.00 |
|
| LY428370 | Transient overexpression lysate of microtubule-associated protein, RP/EB family, member 2 (MAPRE2), transcript variant 3 |
CNY 3,080.00 |
|
| PH300259 | MAPRE2 MS Standard C13 and N15-labeled recombinant protein (NP_055083) |
CNY 19,520.00 |
|
| TP300259 | Recombinant protein of human microtubule-associated protein, RP/EB family, member 2 (MAPRE2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP326779 | Purified recombinant protein of Homo sapiens microtubule-associated protein, RP/EB family, member 2 (MAPRE2), transcript variant 3, 20 µg |
CNY 2,900.00 |
