United States
Germany
Japan
United Kingdom
China
EDC3 (NM_001142444) Human Mass Spec Standard
CAT＃: PH327114
EDC3 MS Standard C13 and N15-labeled recombinant protein (NP_001135916)
View other "EDC3" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | EDC3 MS Standard C13 and N15-labeled recombinant protein (NP_001135916) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC227114 |
| Predicted MW | 56.1 kDa |
| Protein Sequence |
>RC227114 protein sequence
Red=Cloning site Green=Tags(s) MATDWLGSIVSINCGDSLGVYQGRVSAVDQVSQTISLTRPFHNGVKCLVPEVTFRAGDITELKILEIPGP GDNQHFGDLHQTELGPSGAGCQVGINQNGTGKFVKKPASSSSAPQNIPKRTDVKSQDVAVSPQQQQCSKS YVDRHMESLSQSKSFRRRHNSWSSSSRHPNQATPKKSGLKNGQMKNKDDECFGDDIEEIPDTDFDFEGNL ALFDKAAVFEEIDTYERRSGTRSRGIPNERPTRYRHDENILESEPIVYRRIIVPHNVSKEFCTDSGLVVP SISYELHKKLLSVAEKHGLTLERRLEMTGVCASQMALTLLGGPNRLNPKNVHQRPTVALLCGPHVKGAQG ISCGRHLANHDVQVILFLPNFVKMLESITNELSLFSKTQGQQVSSLKDLPTSPVDLVINCLDCPENVFLR DQPWYKAAVAWANQNRAPVLSIDPPVHEVEQGIDAKWSLALGLPLPLGEHAGRIYLCDIGIPQQVFQEVG INYHSPFGCKFVIPLHSA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001135916 |
| RefSeq Size | 3871 |
| RefSeq ORF | 1524 |
| Synonyms | hYjeF_N2-15q23; LSM16; MRT50; YJDC; YJEFN2 |
| Locus ID | 80153 |
| Cytogenetics | 15q24.1 |
| Summary | This gene encodes a protein that is important in mRNA degradation. The encoded protein is a component of a decapping complex that promotes efficient removal of the monomethylguanosine (m7G) cap from mRNAs, as part of the 5' to 3' mRNA decay pathway. Mutations in this gene have been identified in human patients with an autosomal recessive form of intellectual disability. [provided by RefSeq, May 2017] |
| Protein Pathways | RNA degradation |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410908 | EDC3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428097 | EDC3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428098 | EDC3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410908 | Transient overexpression lysate of enhancer of mRNA decapping 3 homolog (S. cerevisiae) (EDC3), transcript variant 3 |
CNY 3,080.00 |
|
| LY428097 | Transient overexpression lysate of enhancer of mRNA decapping 3 homolog (S. cerevisiae) (EDC3), transcript variant 1 |
CNY 3,080.00 |
|
| LY428098 | Transient overexpression lysate of enhancer of mRNA decapping 3 homolog (S. cerevisiae) (EDC3), transcript variant 2 |
CNY 3,080.00 |
|
| PH302321 | EDC3 MS Standard C13 and N15-labeled recombinant protein (NP_079359) |
CNY 19,520.00 |
|
| PH326857 | EDC3 MS Standard C13 and N15-labeled recombinant protein (NP_001135915) |
CNY 19,520.00 |
|
| TP302321 | Recombinant protein of human enhancer of mRNA decapping 3 homolog (S. cerevisiae) (EDC3), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP326857 | Recombinant protein of human enhancer of mRNA decapping 3 homolog (S. cerevisiae) (EDC3), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP327114 | Recombinant protein of human enhancer of mRNA decapping 3 homolog (S. cerevisiae) (EDC3), transcript variant 2, 20 µg |
CNY 2,900.00 |
