TPM4 (NM_001145160) Human Mass Spec Standard
CAT#: PH327534
TPM4 MS Standard C13 and N15-labeled recombinant protein (NP_001138632)
View other "TPM4" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | TPM4 MS Standard C13 and N15-labeled recombinant protein (NP_001138632) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC227534 |
Predicted MW | 32.5 kDa |
Protein Sequence |
>RC227534 representing NM_001145160
Red=Cloning site Green=Tags(s) MEAIKKKMQMLKLDKENAIDRAEQAEADKKAAEDKCKQVEEELTHLQKKLKGTEDELDKYSEDLKDAQEK LELTEKKASDAEGDVAALNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEK MEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGELERAEERAEVSELKCGDLEEELKNVTNNLKSLEAA SEKYSEKEDKYEEEIKLLSDKLKEAETRAEFAERTVAKLEKTIDDLEEKLAQAKEENVGLHQTLDQTLNE LNCI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001138632 |
RefSeq ORF | 852 |
Synonyms | HEL-S-108 |
Locus ID | 7171 |
Cytogenetics | 19p13.12-p13.11 |
Summary | This gene encodes a member of the tropomyosin family of actin-binding proteins involved in the contractile system of striated and smooth muscles and the cytoskeleton of non-muscle cells. Tropomyosins are dimers of coiled-coil proteins that polymerize end-to-end along the major groove in most actin filaments. They provide stability to the filaments and regulate access of other actin-binding proteins. In muscle cells, they regulate muscle contraction by controlling the binding of myosin heads to the actin filament. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2009] |
Protein Pathways | Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM) |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418787 | TPM4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428735 | TPM4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418787 | Transient overexpression lysate of tropomyosin 4 (TPM4), transcript variant 2 |
CNY 3,080.00 |
|
LY428735 | Transient overexpression lysate of tropomyosin 4 (TPM4), transcript variant 1 |
CNY 3,080.00 |
|
PH301133 | TPM4 MS Standard C13 and N15-labeled recombinant protein (NP_003281) |
CNY 19,520.00 |
|
TP301133 | Recombinant protein of human tropomyosin 4 (TPM4), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP327534 | Purified recombinant protein of Homo sapiens tropomyosin 4 (TPM4), transcript variant 1, 20 µg |
CNY 2,900.00 |