CRABP2 (NM_001878) Human Recombinant Protein

CAT#: TP300221

Recombinant protein of human cellular retinoic acid binding protein 2 (CRABP2), 20 µg

Size: 20 ug 100 ug 1 mg



  View other "CRABP2" proteins (3)

Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00

CNY 6,650.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
CRABP2 mouse monoclonal antibody, clone OTI10D6 (formerly 10D6)
    • 100 ul

CNY 1,999.00
CNY 2,700.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC200221 protein sequence
Red=Cloning site Green=Tags(s)

MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGE
EFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 15.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001869
Locus ID 1382
UniProt ID P29373
Refseq Size 1088
Cytogenetics 1q23.1
Refseq ORF 414
Synonyms CRABP-II; RBP6
Summary This gene encodes a member of the retinoic acid (RA, a form of vitamin A) binding protein family and lipocalin/cytosolic fatty-acid binding protein family. The protein is a cytosol-to-nuclear shuttling protein, which facilitates RA binding to its cognate receptor complex and transfer to the nucleus. It is involved in the retinoid signaling pathway, and is associated with increased circulating low-density lipoprotein cholesterol. Alternatively spliced transcript variants encoding the same protein have been found for this gene.[provided by RefSeq, Dec 2010]
Protein Families Druggable Genome, Transcription Factors
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Other Versions

Customer Reviews 
Loading...