PACSIN2 (NM_007229) Human Recombinant Protein
CAT#: TP300237
Recombinant protein of human protein kinase C and casein kinase substrate in neurons 2 (PACSIN2), 20 µg
View other "PACSIN2" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200237 protein sequence
Red=Cloning site Green=Tags(s) MSVTYDDSVGVEVSSDSFWEVGNYKRTVKRIDDGHRLCSDLMNCLHERARIEKAYAQQLTEWARRWRQLV EKGPQYGTVEKAWMAFMSEAERVSELHLEVKASLMNDDFEKIKNWQKEAFHKQMMGGFKETKEAEDGFRK AQKPWAKKLKEVEAAKKAHHAACKEEKLAISREANSKADPSLNPEQLKKLQDKIEKCKQDVLKTKEKYEK SLKELDQGTPQYMENMEQVFEQCQQFEEKRLRFFREVLLEVQKHLDLSNVAGYKAIYHDLEQSIRAADAV EDLRWFRANHGPGMAMNWPQFEEWSADLNRTLSRREKKKATDGVTLTGINQTGDQSLPSKPSSTLNVPSN PAQSAQSQSSYNPFEDEDDTGSTVSEKDDTKAKNVSSYEKTQSYPTDWSDDESNNPFSSTDANGDSNPFD DDATSGTEVRVRALYDYEGQEHDELSFKAGDELTKMEDEDEQGWCKGRLDNGQVGLYPANYVEAIQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 55.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_009160 |
Locus ID | 11252 |
UniProt ID | Q9UNF0 |
Refseq Size | 3292 |
Cytogenetics | 22q13.2 |
Refseq ORF | 1458 |
Synonyms | SDPII |
Summary | This gene is a member of the protein kinase C and casein kinase substrate in neurons family. The encoded protein is involved in linking the actin cytoskeleton with vesicle formation by regulating tubulin polymerization. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2010] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416115 | PACSIN2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC433094 | PACSIN2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416115 | Transient overexpression lysate of protein kinase C and casein kinase substrate in neurons 2 (PACSIN2) |
CNY 3,080.00 |
|
LY433094 | Transient overexpression lysate of protein kinase C and casein kinase substrate in neurons 2 (PACSIN2), transcript variant 3 |
CNY 3,080.00 |
|
PH300237 | PACSIN2 MS Standard C13 and N15-labeled recombinant protein (NP_009160) |
CNY 19,520.00 |
其它PACSIN2产品