GRB7 (NM_001030002) Human Recombinant Protein
CAT#: TP300330
Recombinant protein of human growth factor receptor-bound protein 7 (GRB7), transcript variant 2, 20 µg
View other "GRB7" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200330 protein sequence
Red=Cloning site Green=Tags(s) MELDLSPPHLSSSPEDLCPAPGTPPGTPRPPDTPLPEEVKRSQPLLIPTTGRKLREEERRATSLPSIPNP FPELCSPPSQSPILGGPSSARGLLPRDASRPHVVKVYSEDGACRSVEVAAGATARHVCEMLVQRAHALSD ETWGLVECHPHLALERGLEDHESVVEVQAAWPVGGDSRFVFRKNFAKYELFKSSPHSLFPEKMVSSCLDA HTGISHEDLIQNFLNAGSFPEIQGFLQLRGSGRKLWKRFFCFLRRSGLYYSTKGTSKDPRHLQYVADVNE SNVYVVTQGRKLYGMPTDFGFCVKPNKLRNGHKGLRIFCSEDEQSRTCWLAAFRLFKYGVQLYKNYQQAQ SRHLHPSCLGSPPLRSASDNTLVAMDFSGHAGRVIENPREALSVALEEAQAWRKKTNHRLSLPMPASGTS LSAAIHRTQLWFHGRISREESQRLIGQQGLVDGLFLVRESQRNPQGFVLSLCHLQKVKHYLILPSEEEGR LYFSMDDGQTRFTDLLQLVEFHQLNRGILPCLLRHCCTRVAL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 59.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001025173 |
Locus ID | 2886 |
UniProt ID | Q14451 |
Refseq Size | 2130 |
Cytogenetics | 17q12 |
Refseq ORF | 1596 |
Summary | The product of this gene belongs to a small family of adapter proteins that are known to interact with a number of receptor tyrosine kinases and signaling molecules. This gene encodes a growth factor receptor-binding protein that interacts with epidermal growth factor receptor (EGFR) and ephrin receptors. The protein plays a role in the integrin signaling pathway and cell migration by binding with focal adhesion kinase (FAK). Several transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jun 2011] |
Protein Families | Druggable Genome, Embryonic stem cells, Stem cell - Pluripotency |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401639 | GRB7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422282 | GRB7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401639 | Transient overexpression lysate of growth factor receptor-bound protein 7 (GRB7), transcript variant 1 |
CNY 3,080.00 |
|
LY422282 | Transient overexpression lysate of growth factor receptor-bound protein 7 (GRB7), transcript variant 2 |
CNY 3,080.00 |
|
PH300330 | GRB7 MS Standard C13 and N15-labeled recombinant protein (NP_001025173) |
CNY 19,520.00 |