Ezrin (EZR) (NM_003379) Human Recombinant Protein
CAT#: TP300404
Recombinant protein of human ezrin (EZR), transcript variant 1, 20 µg
View other "Ezrin" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 2 publications. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200404 protein sequence
Red=Cloning site Green=Tags(s) MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLKLDKKVSAQEV RKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKE VHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKN KKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRI LQLCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMREKEELMLR LQDYEEKTKKAERELSEQIQRALQLEEERKRAQEEAERLEADRMAALRAKEELERQAVDQIKSQEQLAAE LAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEELHLVMTAPPPPPPPVYEPVSYHVQESLQ DEGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQRQLLTLSSELSQARDENKRTHNDIIHNENMRQ GRDKYKTLRQIRQGNTKQRIDEFEAL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 69.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | ELISA capture for autoantibodies (PMID: 27146838) |
Reference Data | |
RefSeq | NP_003370 |
Locus ID | 7430 |
UniProt ID | P15311 |
Refseq Size | 3172 |
Cytogenetics | 6q25.3 |
Refseq ORF | 1758 |
Synonyms | CVIL; CVL; HEL-S-105; VIL2 |
Summary | The cytoplasmic peripheral membrane protein encoded by this gene functions as a protein-tyrosine kinase substrate in microvilli. As a member of the ERM protein family, this protein serves as an intermediate between the plasma membrane and the actin cytoskeleton. This protein plays a key role in cell surface structure adhesion, migration and organization, and it has been implicated in various human cancers. A pseudogene located on chromosome 3 has been identified for this gene. Alternatively spliced variants have also been described for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Leukocyte transendothelial migration, Pathogenic Escherichia coli infection, Regulation of actin cytoskeleton |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
A prospective study of autoantibodies to Ezrin and pancreatic cancer risk
,Sun, Y;Wu, J;Cai, H;Wang, S;Liu, Q;Blot, WJ;Shu, XO;Cai, Q;,
Cancer Causes Control
,PubMed ID 27146838
[EZR]
|
Are ERM (ezrin/radixin/moesin) proteins targets for autoantibodies in demyelinating neuropathies?
,Miyaji, K;Shahrizaila, N;Umapathi, T;Chan, YC;Hirata, K;Yuki, N;,
Hum. Immunol.
,PubMed ID 25286001
[EZR]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401164 | EZR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426350 | EZR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401164 | Transient overexpression lysate of ezrin (EZR), transcript variant 1 |
CNY 3,080.00 |
|
LY426350 | Transient overexpression lysate of ezrin (EZR), transcript variant 2 |
CNY 3,080.00 |
|
PH300404 | EZR MS Standard C13 and N15-labeled recombinant protein (NP_003370) |
CNY 19,520.00 |
|
PH325989 | EZR MS Standard C13 and N15-labeled recombinant protein (NP_001104547) |
CNY 19,520.00 |
|
TP325989 | Recombinant protein of human ezrin (EZR), transcript variant 2, 20 µg |
CNY 2,900.00 |