AK6 (NM_016283) Human Recombinant Protein
CAT#: TP300412
Recombinant protein of human TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa (TAF9), transcript variant 2, 20 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200412 protein sequence
Red=Cloning site Green=Tags(s) MLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMR EGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEI VHQLPSNKPEELENNVDQILKWIEQWIKDHNS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 19.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057367 |
Locus ID | 102157402 |
UniProt ID | Q9Y3D8 |
Refseq Size | 962 |
Cytogenetics | 5q13.2 |
Refseq ORF | 516 |
Synonyms | AD-004; CGI-137; CINAP; CIP; hCINAP |
Summary | This gene encodes a protein that belongs to the adenylate kinase family of enzymes. The protein has a nuclear localization and contains Walker A (P-loop) and Walker B motifs and a metal-coordinating residue. The protein may be involved in regulation of Cajal body formation. In human, AK6 and TAF9 (GeneID: 6880) are two distinct genes that share 5' exons. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402534 | AK6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423136 | AK6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC425392 | AK6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402534 | Transient overexpression lysate of TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa (TAF9), transcript variant 2 |
CNY 3,080.00 |
|
LY423136 | Transient overexpression lysate of TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa (TAF9), transcript variant 3 |
CNY 3,080.00 |
|
PH300412 | TAF9 MS Standard C13 and N15-labeled recombinant protein (NP_057367) |
CNY 19,520.00 |