Calumenin (CALU) (NM_001219) Human Recombinant Protein
CAT#: TP300589
Recombinant protein of human calumenin (CALU), transcript variant 1, 20 µg
View other "Calumenin" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200589 protein sequence
Red=Cloning site Green=Tags(s) MDLRQFLMCLSLCTAFALSKPTEKKDRVHHEPQLSDKVHNDAQSFDYDHDAFLGAEEAKTFDQLTPEESK ERLGKIVSKIDGDKDGFVTVDELKDWIKFAQKRWIYEDVERQWKGHDLNEDGLVSWEEYKNATYGYVLDD PDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDL EEYIGDMYSHDGNTDEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQN KDGKLTKEEIVDKYDLFVGSQATDFGEALVRHDEF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 34.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001210 |
Locus ID | 813 |
UniProt ID | O43852 |
Refseq Size | 5366 |
Cytogenetics | 7q32.1 |
Refseq ORF | 945 |
Summary | The product of this gene is a calcium-binding protein localized in the endoplasmic reticulum (ER) and it is involved in such ER functions as protein folding and sorting. This protein belongs to a family of multiple EF-hand proteins (CERC) that include reticulocalbin, ERC-55, and Cab45 and the product of this gene. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Oct 2008] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400488 | CALU HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427231 | CALU HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400488 | Transient overexpression lysate of calumenin (CALU), transcript variant 1 |
CNY 3,080.00 |
|
LY427231 | Transient overexpression lysate of calumenin (CALU), transcript variant 2 |
CNY 3,080.00 |
|
PH300589 | CALU MS Standard C13 and N15-labeled recombinant protein (NP_001210) |
CNY 19,520.00 |
|
TP720752 | Purified recombinant protein of Human calumenin (CALU), transcript variant 1 |
CNY 3,140.00 |
其它Calumenin产品