FKBP12 (FKBP1A) (NM_054014) Human Recombinant Protein
CAT#: TP300662
Recombinant protein of human FK506 binding protein 1A, 12kDa (FKBP1A), transcript variant 12A, 20 µg
View other "FKBP12" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200662 protein sequence
Red=Cloning site Green=Tags(s) MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVG QRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_463460 |
Locus ID | 2280 |
UniProt ID | P62942 |
Refseq Size | 901 |
Cytogenetics | 20p13 |
Refseq ORF | 324 |
Synonyms | FKBP-1A; FKBP-12; FKBP1; FKBP12; PKC12; PKCI2; PPIASE |
Summary | The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. The protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It interacts with several intracellular signal transduction proteins including type I TGF-beta receptor. It also interacts with multiple intracellular calcium release channels, and coordinates multi-protein complex formation of the tetrameric skeletal muscle ryanodine receptor. In mouse, deletion of this homologous gene causes congenital heart disorder known as noncompaction of left ventricular myocardium. Multiple alternatively spliced variants, encoding the same protein, have been identified. The human genome contains five pseudogenes related to this gene, at least one of which is transcribed. [provided by RefSeq, Sep 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400279 | FKBP1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC409302 | FKBP1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400279 | Transient overexpression lysate of FK506 binding protein 1A, 12kDa (FKBP1A), transcript variant 12B |
CNY 3,080.00 |
|
LY409302 | Transient overexpression lysate of FK506 binding protein 1A, 12kDa (FKBP1A), transcript variant 12A |
CNY 3,080.00 |
|
PH300662 | FKBP1A MS Standard C13 and N15-labeled recombinant protein (NP_463460) |
CNY 19,520.00 |
|
PH301237 | FKBP1A MS Standard C13 and N15-labeled recombinant protein (NP_000792) |
CNY 19,520.00 |
|
TP301237 | Recombinant protein of human FK506 binding protein 1A, 12kDa (FKBP1A), transcript variant 12B, 20 µg |
CNY 2,900.00 |