CD79B (NM_001039933) Human Recombinant Protein
CAT#: TP300665
Recombinant protein of human CD79b molecule, immunoglobulin-associated beta (CD79B), transcript variant 3, 20 µg
View other "CD79B" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200665 representing NM_001039933
Red=Cloning site Green=Tags(s) MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSA SGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTEL RVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDI VTLRTGEVKWSVGEHPGQE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 23.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001035022 |
Locus ID | 974 |
UniProt ID | P40259 |
Refseq Size | 1303 |
Cytogenetics | 17q23.3 |
Refseq ORF | 1428 |
Synonyms | AGM6; B29; IGB |
Summary | The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-beta protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | B cell receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421857 | CD79B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424598 | CD79B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY421857 | Transient overexpression lysate of CD79b molecule, immunoglobulin-associated beta (CD79B), transcript variant 3 |
CNY 3,080.00 |
|
LY424598 | Transient overexpression lysate of CD79b molecule, immunoglobulin-associated beta (CD79B), transcript variant 1 |
CNY 3,080.00 |
|
PH300665 | CD79B MS Standard C13 and N15-labeled recombinant protein (NP_001035022) |
CNY 19,520.00 |
|
TP720747 | Purified recombinant protein of Human CD79b molecule, immunoglobulin-associated beta (CD79B), transcript variant 3 |
CNY 3,140.00 |