GNAT2 (NM_005272) Human Recombinant Protein
CAT#: TP300685
Recombinant protein of human guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2 (GNAT2), 20 µg
View other "GNAT2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 6,281.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200685 protein sequence
Red=Cloning site Green=Tags(s) MGSGASAEDKELAKRSKELEKKLQEDADKEAKTVKLLLLGAGESGKSTIVKQMKIIHQDGYSPEECLEFK AIIYGNVLQSILAIIRAMTTLGIDYAEPSCADDGRQLNNLADSIEEGTMPPELVEVIRRLWKDGGVQACF ERAAEYQLNDSASYYLNQLERITDPEYLPSEQDVLRSRVKTTGIIETKFSVKDLNFRMFDVGGQRSERKK WIHCFEGVTCIIFCAALSAYDMVLVEDDEVNRMHESLHLFNSICNHKFFAATSIVLFLNKKDLFEEKIKK VHLSICFPEYDGNNSYDDAGNYIKSQFLDLNMRKDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKD CGLF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 40 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005263 |
Locus ID | 2780 |
UniProt ID | P19087 |
Refseq Size | 1384 |
Cytogenetics | 1p13.3 |
Refseq ORF | 1062 |
Synonyms | ACHM4; GNATC |
Summary | Transducin is a 3-subunit guanine nucleotide-binding protein (G protein) which stimulates the coupling of rhodopsin and cGMP-phoshodiesterase during visual impulses. The transducin alpha subunits in rods and cones are encoded by separate genes. This gene encodes the alpha subunit in cones. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401620 | GNAT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401620 | Transient overexpression lysate of guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2 (GNAT2) |
CNY 3,080.00 |
|
PH300685 | GNAT2 MS Standard C13 and N15-labeled recombinant protein (NP_005263) |
CNY 19,520.00 |