ALDH1A1 (NM_000689) Human Recombinant Protein
CAT#: TP300723
Recombinant protein of human aldehyde dehydrogenase 1 family, member A1 (ALDH1A1), 20 µg
View other "ALDH1A1" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200723 representing NM_000689
Red=Cloning site Green=Tags(s) MSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQA FQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAGWADKI QGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIK EAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLA DADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQ YDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKR ANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVK TVTVKISQKNS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 54.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000680 |
Locus ID | 216 |
UniProt ID | P00352 |
Refseq Size | 2116 |
Cytogenetics | 9q21.13 |
Refseq ORF | 1503 |
Synonyms | ALDC; ALDH-E1; ALDH1; ALDH11; HEL-9; HEL-S-53e; HEL12; PUMB1; RALDH1 |
Summary | The protein encoded by this gene belongs to the aldehyde dehydrogenase family. Aldehyde dehydrogenase is the next enzyme after alcohol dehydrogenase in the major pathway of alcohol metabolism. There are two major aldehyde dehydrogenase isozymes in the liver, cytosolic and mitochondrial, which are encoded by distinct genes, and can be distinguished by their electrophoretic mobility, kinetic properties, and subcellular localization. This gene encodes the cytosolic isozyme. Studies in mice show that through its role in retinol metabolism, this gene may also be involved in the regulation of the metabolic responses to high-fat diet. [provided by RefSeq, Mar 2011] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS |
Protein Pathways | Metabolic pathways, Retinol metabolism |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Stemness marker ALDH1A1 promotes tumor angiogenesis via retinoic acid/HIF-1α/VEGF signalling in MCF-7 breast cancer cells
,null,
Journal of Experimental & Clinical Cancer Research : CR
,PubMed ID 30541574
[ALDH1A1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400230 | ALDH1A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400230 | Transient overexpression lysate of aldehyde dehydrogenase 1 family, member A1 (ALDH1A1) |
CNY 3,080.00 |
|
PH300723 | ALDH1A1 MS Standard C13 and N15-labeled recombinant protein (NP_000680) |
CNY 19,520.00 |
|
TP720901 | Purified recombinant protein of Human aldehyde dehydrogenase 1 family, member A1 (ALDH1A1) |
CNY 3,140.00 |
其它ALDH1A1产品