URM1 (NM_030914) Human Recombinant Protein
CAT#: TP300854
Recombinant protein of human ubiquitin related modifier 1 homolog (S. cerevisiae) (URM1), transcript variant 1, 20 µg
View other "URM1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200854 protein sequence
Red=Cloning site Green=Tags(s) MAAPLSVEVEFGGGAELLFDGIKKHRVTLPGQEEPWDIRNLLIWIKKNLLKERPELFIQGDSVRPGILVL INDADWELLGELDYQLQDQDSVLFISTLHGG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_112176 |
Locus ID | 81605 |
UniProt ID | Q9BTM9 |
Refseq Size | 2650 |
Cytogenetics | 9q34.11 |
Refseq ORF | 303 |
Synonyms | C9orf74 |
Summary | Acts as a sulfur carrier required for 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of cytosolic tRNA(Lys), tRNA(Glu) and tRNA(Gln). Serves as sulfur donor in tRNA 2-thiolation reaction by being thiocarboxylated (-COSH) at its C-terminus by MOCS3. The sulfur is then transferred to tRNA to form 2-thiolation of mcm(5)S(2)U. Also acts as a ubiquitin-like protein (UBL) that is covalently conjugated via an isopeptide bond to lysine residues of target proteins such as MOCS3, ATPBD3, CTU2, USP15 and CAS. The thiocarboxylated form serves as substrate for conjugation and oxidative stress specifically induces the formation of UBL-protein conjugates.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410664 | URM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410664 | Transient overexpression lysate of ubiquitin related modifier 1 homolog (S. cerevisiae) (URM1), transcript variant 1 |
CNY 3,080.00 |
|
PH300854 | URM1 MS Standard C13 and N15-labeled recombinant protein (NP_112176) |
CNY 19,520.00 |