C11orf73 (HIKESHI) (NM_016401) Human Recombinant Protein
CAT#: TP300866
Recombinant protein of human chromosome 11 open reading frame 73 (C11orf73), transcript variant 1, 20 µg
View other "C11orf73" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200866 protein sequence
Red=Cloning site Green=Tags(s) MFGCLVAGRLVQTAAQQVAEDKFVFDLPDYESINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLL GFVTNGKPSAIFKISGLKSGEGSQHPFGAMNIVRTPSVAQIGISVELLDSMAQQTPVGNAAVSSVDSFTQ FTQKMLDNFYNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWKT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057485 |
Locus ID | 51501 |
UniProt ID | Q53FT3 |
Refseq Size | 1187 |
Cytogenetics | 11q14.2 |
Refseq ORF | 591 |
Synonyms | C11orf73; HLD13; HSPC138; HSPC179; L7RN6; OPI10 |
Summary | This gene encodes an evolutionarily conserved nuclear transport receptor that mediates heat-shock-induced nuclear import of 70 kDa heat-shock proteins (Hsp70s) through interactions with FG-nucleoporins. The protein mediates transport of the ATP form but not the ADP form of Hsp70 proteins under conditions of heat shock stress. Structural analyses demonstrate that the protein forms an asymmetric homodimer and that the N-terminal domain consists of a jelly-roll/beta-sandwich fold structure that contains hydrophobic pockets involved in FG-nucleoporin recognition. Reduction of RNA expression levels in HeLa cells using small interfering RNAs results in inhibition of heat shock-induced nuclear accumulation of Hsp70s, indicating a role for this gene in regulation of Hsp70 nuclear import during heat shock stress. [provided by RefSeq, Apr 2016] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413999 | C11orf73 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413999 | Transient overexpression lysate of chromosome 11 open reading frame 73 (C11orf73), transcript variant 1 |
CNY 3,080.00 |
|
PH300866 | C11orf73 MS Standard C13 and N15-labeled recombinant protein (NP_057485) |
CNY 19,520.00 |
其它C11orf73产品