AKIRIN2 (NM_018064) Human Recombinant Protein
CAT#: TP300881
Recombinant protein of human akirin 2 (AKIRIN2), 20 µg
View other "AKIRIN2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200881 protein sequence
Red=Cloning site Green=Tags(s) MACGATLKRTLDFDPLLSPASPKRRRCAPLSAPTSAAASPLSAAAATAASFSAAAASPQKYLRMEPSPFG DVSSRLTTEQILYNIKQEYKRMQKRRHLETSFQQTDPCCTSDAQPHAFLLSGPASPGTSSAASSPLKKEQ PLFTLRQVGMICERLLKEREEKVREEYEEILNTKLAEQYDAFVKFTHDQIMRRYGEQPASYVS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060534 |
Locus ID | 55122 |
UniProt ID | Q53H80, Q9NW35 |
Refseq Size | 1948 |
Cytogenetics | 6q15 |
Refseq ORF | 609 |
Synonyms | C6orf166; dJ486L4.2; FBI1 |
Summary | Required for the innate immune response. Downstream effector of the Toll-like receptor (TLR), TNF and IL-1 beta signaling pathways leading to the production of IL-6. Forms a complex with YWHAB that acts to repress transcription of DUSP1 (By similarity).[UniProtKB/Swiss-Prot Function] |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Function of cofactor Akirin2 in the regulation of gene expression in model human Caucasian neutrophil-like HL60 cells
,null,
Bioscience Reports
,PubMed ID 34291801
[AKIRIN2]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
其它AKIRIN2产品