OTUD5 (NM_017602) Human Recombinant Protein
CAT#: TP300893
Recombinant protein of human OTU domain containing 5 (OTUD5), transcript variant 1, 20 µg
View other "OTUD5" proteins (9)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200893 representing NM_017602
Red=Cloning site Green=Tags(s) MTILPKKKPPPPDADPANEPPPPGPMPPAPRRGGGVGVGGGGTGVGGGDRDRDSGVVGARPRASPPPQGP LPGPPGALHRWALAVPPGAVAGPRPQQASPPPCGGPGGPGGGPGDALGAAAAGVGAAGVVVGVGGAVGVG GCCSGPGHSKRRRQAPGVGAVGGGSPEREEVGAGYNSEDEYEAAAARIEAMDPATVEQQEHWFEKALRDK KGFIIKQMKEDGACLFRAVADQVYGDQDMHEVVRKHCMDYLMKNADYFSNYVTEDFTTYINRKRKNNCHG NHIEMQAMAEMYNRPVEVYQYSTGTSAVEPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNPNKATIGVGL GLPSFKPGFAEQSLMKNAIKTSEESWIEQQMLEDKKRATDWEATNEAIEEQVARESYLQWLRDQEKQARQ VRGPSQPRKASATCSSATAAASSGLEEWTSRSPRQRSSASSPEHPELHAELGMKPPSPGTVLALAKPPSP CAPGTSSQFSAGADRATSPLVSLYPALECRALIQQMSPSAFGLNDWDDDEILASVLAVSQQEYLDSMKKN KVHRDPPPDKS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 60.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060072 |
Locus ID | 55593 |
UniProt ID | Q96G74, A0A024QZ09 |
Refseq Size | 2759 |
Cytogenetics | Xp11.23 |
Refseq ORF | 1713 |
Synonyms | DUBA; MCAND |
Summary | This gene encodes a member of the OTU (ovarian tumor) domain-containing cysteine protease superfamily. The OTU domain confers deubiquitinase activity and the encoded protein has been shown to suppress the type I interferon-dependent innate immune response by cleaving the polyubiquitin chain from an essential type I interferon adaptor protein. Cleavage results in disassociation of the adaptor protein from a downstream signaling complex and disruption of the type I interferon signaling cascade. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Oct 2008] |
Protein Families | Protease |
Protein Pathways | RIG-I-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413689 | OTUD5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427830 | OTUD5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427831 | OTUD5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427832 | OTUD5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413689 | Transient overexpression lysate of OTU domain containing 5 (OTUD5), transcript variant 1 |
CNY 3,080.00 |
|
LY427830 | Transient overexpression lysate of OTU domain containing 5 (OTUD5), transcript variant 2 |
CNY 3,080.00 |
|
LY427831 | Transient overexpression lysate of OTU domain containing 5 (OTUD5), transcript variant 3 |
CNY 3,080.00 |
|
LY427832 | Transient overexpression lysate of OTU domain containing 5 (OTUD5), transcript variant 4 |
CNY 3,080.00 |
|
PH300893 | OTUD5 MS Standard C13 and N15-labeled recombinant protein (NP_060072) |
CNY 14,250.00 |