DARPP32 (PPP1R1B) (NM_181505) Human Recombinant Protein
CAT#: TP300916L
Recombinant protein of human protein phosphatase 1, regulatory (inhibitor) subunit 1B (PPP1R1B), transcript variant 2, 1 mg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 36,000.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200916 protein sequence
Red=Cloning site Green=Tags(s) MLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEED ELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDG GSEDQVEDPALSEPGEEPQRPSPSEPGT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_852606 |
Locus ID | 84152 |
UniProt ID | Q9UD71, A0A024R1R3 |
Refseq Size | 1530 |
Cytogenetics | 17q12 |
Refseq ORF | 504 |
Synonyms | DARPP-32; DARPP32 |
Summary | This gene encodes a bifunctional signal transduction molecule. Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor. As a target for dopamine, this gene may serve as a therapeutic target for neurologic and psychiatric disorders. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
其它DARPP32产品