PDXK (NM_003681) Human Recombinant Protein
CAT#: TP300975
Recombinant protein of human pyridoxal (pyridoxine, vitamin B6) kinase (PDXK), 20 µg
View other "PDXK" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200975 protein sequence
Red=Cloning site Green=Tags(s) MEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLR LNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKV VPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNP AGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGE GVRPSPMQLELRMVQSKRDIEDPEIVVQATVL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 34.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003672 |
Locus ID | 8566 |
UniProt ID | O00764, V9HWC3 |
Refseq Size | 7390 |
Cytogenetics | 21q22.3 |
Refseq ORF | 936 |
Synonyms | C21orf97; C21orf124; HEL-S-1a; HMSN6C; PKH; PNK; PRED79 |
Summary | The protein encoded by this gene phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. The encoded protein is cytoplasmic and probably acts as a homodimer. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Vitamin B6 metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418499 | PDXK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418499 | Transient overexpression lysate of pyridoxal (pyridoxine, vitamin B6) kinase (PDXK) |
CNY 3,080.00 |
|
PH300975 | PDXK MS Standard C13 and N15-labeled recombinant protein (NP_003672) |
CNY 19,520.00 |