NSFL1C (NM_016143) Human Recombinant Protein
CAT#: TP301022
Recombinant protein of human NSFL1 (p97) cofactor (p47) (NSFL1C), transcript variant 1, 20 µg
View other "NSFL1C" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201022 protein sequence
Red=Cloning site Green=Tags(s) MAAERQEALREFVAVTGAEEDRARFFLESAGWDLQIALASFYEDGGDEDIVTISQATPSSVSRGTAPSDN RVTSFRDLIHDQDEDEEEEEGQRFYAGGSERSGQQIVGPPRKKSPNELVDDLFKGAKEHGAVAVERVTKS PGETSKPRPFAGGGYRLGAAPEEESAYVAGEKRQHSSQDVHVVLKLWKSGFSLDNGELRSYQDPSNAQFL ESIRRGEVPAELRRLAHGGQVNLDMEDHRDEDFVKPKGAFKAFTGEGQKLGSTAPQVLSTSSPAQQAENE AKASSSILIDESEPTTNIQIRLADGGRLVQKFNHSHRISDIRLFIVDARPAMAATSFILMTTFPNKELAD ESQTLKEANLLNAVIVQRLT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 40.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057227 |
Locus ID | 55968 |
UniProt ID | Q9UNZ2, Q53FE8 |
Refseq Size | 3568 |
Cytogenetics | 20p13 |
Refseq ORF | 1110 |
Synonyms | dJ776F14.1; P47; UBX1; UBXD10; UBXN2C |
Summary | N-ethylmaleimide-sensitive factor (NSF) and valosin-containing protein (p97) are two ATPases known to be involved in transport vesicle/target membrane fusion and fusions between membrane compartments. A trimer of the protein encoded by this gene binds a hexamer of cytosolic p97 and is required for p97-mediated regrowth of Golgi cisternae from mitotic Golgi fragments. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 8. [provided by RefSeq, May 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402508 | NSFL1C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC412879 | NSFL1C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402508 | Transient overexpression lysate of NSFL1 (p97) cofactor (p47) (NSFL1C), transcript variant 1 |
CNY 3,080.00 |
|
LY412879 | Transient overexpression lysate of NSFL1 (p97) cofactor (p47) (NSFL1C), transcript variant 2 |
CNY 3,080.00 |
|
PH301022 | NSFL1C MS Standard C13 and N15-labeled recombinant protein (NP_057227) |
CNY 19,520.00 |