Phosphoribosyl pyrophosphate amidotransferase (PPAT) (NM_002703) Human Recombinant Protein
CAT#: TP301144
Recombinant protein of human phosphoribosyl pyrophosphate amidotransferase (PPAT), 20 µg
View other "Phosphoribosyl pyrophosphate amidotransferase" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201144 protein sequence
Red=Cloning site Green=Tags(s) MELEELGIREECGVFGCIASGEWPTQLDVPHVITLGLVGLQHRGQESAGIVTSDGSSVPTFKSHKGMGLV NHVFTEDNLKKLYVSNLGIGHTRYATTGKCELENCQPFVVETLHGKIAVAHNGELVNAARLRKKLLRHGI GLSTSSDSEMITQLLAYTPPQEQDDTPDWVARIKNLMKEAPTAYSLLIMHRDVIYAVRDPYGNRPLCIGR LIPVSDINDKEKKTSETEGWVVSSESCSFLSIGARYYREVLPGEIVEISRHNVQTLDIISRSEGNPVAFC IFEYVYFARPDSMFEDQMVYTVRYRCGQQLAIEAPVDADLVSTVPESATPAALAYAGKCGLPYVEVLCKN RYVGRTFIQPNMRLRQLGVAKKFGVLSDNFKGKRIVLVDDSIVRGNTISPIIKLLKESGAKEVHIRVASP PIKYPCFMGINIPTKEELIANKPEFDHLAEYLGANSVVYLSVEGLVSSVQEGIKFKKQKEKKHDIMIQEN GNGLECFEKSGHCTACLTGKYPVELEW myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 57.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002694 |
Locus ID | 5471 |
UniProt ID | Q06203, A8K4H7, Q59G63 |
Refseq Size | 3713 |
Cytogenetics | 4q12 |
Refseq ORF | 1551 |
Synonyms | ATASE; GPAT; PRAT |
Summary | The protein encoded by this gene is a member of the purine/pyrimidine phosphoribosyltransferase family. It is a regulatory allosteric enzyme that catalyzes the first step of de novo purine nucleotide biosythetic pathway. This gene and PAICS/AIRC gene, a bifunctional enzyme catalyzing steps six and seven of this pathway, are located in close proximity on chromosome 4, and divergently transcribed from an intergenic region. [provided by RefSeq, Mar 2011] |
Protein Families | Druggable Genome, Protease |
Protein Pathways | Alanine, aspartate and glutamate metabolism, Metabolic pathways, Purine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400951 | PPAT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400951 | Transient overexpression lysate of phosphoribosyl pyrophosphate amidotransferase (PPAT) |
CNY 3,080.00 |
|
PH301144 | PPAT MS Standard C13 and N15-labeled recombinant protein (NP_002694) |
CNY 19,520.00 |
其它Phosphoribosyl pyrophosphate amidotransferase产品