DLST (NM_001933) Human Recombinant Protein
CAT#: TP301220
Recombinant protein of human dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex) (DLST), 20 µg
View other "DLST" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 6,281.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201220 representing NM_001933
Red=Cloning site Green=Tags(s) MLSRSRCVSRAFSRSLSAFQKGNCPLGRRSLPGVSLCQGPGYPNSRKVVINNSVFSVRFFRTTAVCKDDL VTVKTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPSPANGVIEALLVPDGGKVEGGTPL FTLRKTGAAPAKAKPAEAPAAAAPKAEPTAAAVPPPAAPIPTQMPPVPSPSQPPSGKPVSAVKPTVAPPL AEPGAGKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGF MSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITEL GEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGIFDRPVAIGGKVEVRPMMYVAL TYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 48.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001924 |
Locus ID | 1743 |
UniProt ID | P36957, A0A024R6C9 |
Refseq Size | 2828 |
Cytogenetics | 14q24.3 |
Refseq ORF | 1359 |
Synonyms | DLTS; KGD2; PGL7 |
Summary | This gene encodes a mitochondrial protein that belongs to the 2-oxoacid dehydrogenase family. This protein is one of the three components (the E2 component) of the 2-oxoglutarate dehydrogenase complex that catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO(2). Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Oct 2011] |
Protein Pathways | Citrate cycle (TCA cycle), Lysine degradation, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419635 | DLST HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419635 | Transient overexpression lysate of dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex) (DLST) |
CNY 3,080.00 |
|
PH301220 | DLST MS Standard C13 and N15-labeled recombinant protein (NP_001924) |
CNY 19,520.00 |