ARF5 (NM_001662) Human Recombinant Protein
CAT#: TP301363L
Recombinant protein of human ADP-ribosylation factor 5 (ARF5), 1 mg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 36,000.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201363 protein sequence
Red=Cloning site Green=Tags(s) MGLTVSALFSRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGG QDKIRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELT DKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001653 |
Locus ID | 381 |
UniProt ID | P84085 |
Refseq Size | 1096 |
Cytogenetics | 7q32.1 |
Refseq ORF | 540 |
Summary | This gene is a member of the human ADP-ribosylation factor (ARF) gene family. These genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The gene products include 6 ARF proteins and 11 ARF-like proteins and constitute 1 family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2,and ARF3), class II (ARF4 and ARF5) and class III (ARF6). The members of each class share a common gene organization. [provided by RefSeq, Dec 2010] |
Documents
FAQs |
SDS |