United States
Germany
Japan
United Kingdom
China
NDRG1 (NM_006096) Human Recombinant Protein
CAT＃: TP301374
Recombinant protein of human N-myc downstream regulated 1 (NDRG1), transcript variant 2, 20 µg
View other "NDRG1" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201374 protein sequence
Red=Cloning site Green=Tags(s) MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHK TCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTG AGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHT YRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTK TTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGT RSRSHTSEGTRSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 42.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_006087 |
| Locus ID | 10397 |
| UniProt ID | Q92597 |
| Refseq Size | 3123 |
| Cytogenetics | 8q24.22 |
| Refseq ORF | 1182 |
| Synonyms | CAP43; CMT4D; DRG-1; DRG1; GC4; HMSNL; NDR1; NMSL; PROXY1; RIT42; RTP; TARG1; TDD5 |
| Summary | This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein involved in stress responses, hormone responses, cell growth, and differentiation. The encoded protein is necessary for p53-mediated caspase activation and apoptosis. Mutations in this gene are a cause of Charcot-Marie-Tooth disease type 4D, and expression of this gene may be a prognostic indicator for several types of cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, May 2012] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401840 | NDRG1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427604 | NDRG1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401840 | Transient overexpression lysate of N-myc downstream regulated 1 (NDRG1), transcript variant 2 |
CNY 3,080.00 |
|
| LY427604 | Transient overexpression lysate of N-myc downstream regulated 1 (NDRG1), transcript variant 1 |
CNY 3,080.00 |
|
| PH301374 | NDRG1 MS Standard C13 and N15-labeled recombinant protein (NP_006087) |
CNY 19,520.00 |
|
| PH325609 | NDRG1 MS Standard C13 and N15-labeled recombinant protein (NP_001128714) |
CNY 19,520.00 |
|
| TP325609 | Recombinant protein of human N-myc downstream regulated 1 (NDRG1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP720621 | Purified recombinant protein of Human N-myc downstream regulated 1 (NDRG1), transcript variant 2 |
CNY 3,140.00 |
Rabbit anti-NDRG1 Polyclonal Antibody
热销推荐
