United States
Germany
Japan
United Kingdom
China
FAM110A (NM_207121) Human Recombinant Protein
CAT＃: TP301431
Recombinant protein of human family with sequence similarity 110, member A (FAM110A), transcript variant 2, 20 µg
View other "FAM110A" proteins (10)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201431 protein sequence
Red=Cloning site Green=Tags(s) MPVHTLSPGAPSAPALPCRLRTRVPGYLLRGPADGGARKPSAVERLEADKAKYVKSLHVANTRQEPVQPL LSKQPLFSPETRRTVLTPSRRALPGPCRRPQLDLDILSSLIDLCDSPVSPAEASRTPGRAEGAGRPPPAT PPRPPPSTSAVRRVDVRPLPASPARPCPSPGPAAASSPARPPGLQRSKSDLSERFSRAAADLERFFNFCG LDPEEARGLGVAHLARASSDIVSLAGPSAGPGSSEGGCSRRSSVTVEERARERVPYGVSVVERNARVIKW LYGLRQARESPAAEG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 31.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_997004 |
| Locus ID | 83541 |
| UniProt ID | Q9BQ89 |
| Refseq Size | 1619 |
| Cytogenetics | 20p13 |
| Refseq ORF | 885 |
| Synonyms | bA371L19.3; C20orf55; F10 |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404054 | FAM110A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC410535 | FAM110A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420844 | FAM110A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404054 | Transient overexpression lysate of family with sequence similarity 110, member A (FAM110A), transcript variant 2 |
CNY 3,080.00 |
|
| LY410535 | Transient overexpression lysate of family with sequence similarity 110, member A (FAM110A), transcript variant 1 |
CNY 3,080.00 |
|
| LY420844 | Transient overexpression lysate of family with sequence similarity 110, member A (FAM110A), transcript variant 3 |
CNY 3,080.00 |
|
| PH300769 | FAM110A MS Standard C13 and N15-labeled recombinant protein (NP_001035812) |
CNY 19,520.00 |
|
| PH301431 | FAM110A MS Standard C13 and N15-labeled recombinant protein (NP_997004) |
CNY 19,520.00 |
|
| TP300769 | Recombinant protein of human family with sequence similarity 110, member A (FAM110A), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP761331 | Purified recombinant protein of Human family with sequence similarity 110, member A (FAM110A), transcript variant 1, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
其它FAM110A产品
